Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
264 projects found  

2 accessions found for   

Data for CP000826  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000826.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000826_3477 CDS_3862495-3864177 70.3 2.3e-20 1
CP000826_2890 CDS_3185676-3187460 70.2 2.5e-20 1
CP000826_0133 CDS_141667-143208 52.0 5.8e-15 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000826_3477 1/1 364 427 .. 1 66 [. 70.3 2.3e-20
CP000826_2890 1/1 393 461 .. 1 70 [] 70.2 2.5e-20
CP000826_0133 1/1 308 373 .. 1 70 [] 52.0 5.8e-15

Alignments of top-scoring domains:
CP000826_3477: domain 1 of 1, from 364 to 427: score 70.3, E = 2.3e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERa IARELHDs++Q+Ls +++ql l+rr l ++ +ea+e +
CP000826_3 364 ERATIARELHDSLAQALSFLRIQLTLLRRTL--ADSTPEAQEIISDF 408

relarealaevRrllgdLR<-*
+++ +a++++R+ll+++R
CP000826_3 409 DQALADAYRQLRELLTTFR 427

CP000826_2890: domain 1 of 1, from 393 to 461: score 70.2, E = 2.5e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERa IARELHDs++QsLs +k+q++ ++++ ++ ++ + ++++
CP000826_2 393 ERAAIARELHDSIAQSLSCLKMQTSCLQMQG--AELSPANLALVQQM 437

relarealaevRrllgdLR.paal<-*
re ++ a++++R+ll+++R ++
CP000826_2 438 REELNIAYRQLRELLTTFRlRLTE 461

CP000826_0133: domain 1 of 1, from 308 to 373: score 52.0, E = 5.8e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+ ARELHD+vgQ++++i+ q++ ++rl+ + + ++ +++i
CP000826_0 308 TRREVARELHDEVGQTITVIRTQASIIKRLA--PQP--QVMGCAEAI 350

relarealaevRrllgdLRpaal<-*
+la + ++ v ++l++L paal
CP000826_0 351 DTLALRVYDGVHDVLTQLWPAAL 373


Histogram of all scores:
score obs exp (one = represents 17 sequences)
----- --- ---
-14 13 0|=
-13 75 0|=====
-12 166 54|===*======
-11 252 448|=============== *
-10 725 1040|=========================================== *
-9 982 1181|==========================================================*
-8 780 910|============================================== *
-7 634 572|=================================*====
-6 456 323|==================*========
-5 366 173|==========*===========
-4 200 90|=====*======
-3 100 46|==*===
-2 63 23|=*==
-1 36 12|*==
0 17 6|*
1 10 3|*
2 7 1|*
3 2 0|=
> 4 7 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1057.1582
P(chi-square) = 0

Total sequences searched: 4891

Whole sequence top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: