Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
39 projects found  

10 accessions found for Acaryochloris marina MBIC11017  

Data for CP000828  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000828.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000828_6126 CDS_6358490-6352548 83.6 3.6e-24 1
CP000828_0477 CDS_490653-489385 79.5 5.9e-23 1
CP000828_1498 CDS_1549321-1550520 78.5 1.2e-22 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000828_6126 1/1 1766 1833 .. 1 70 [] 83.6 3.6e-24
CP000828_0477 1/1 224 291 .. 1 70 [] 79.5 5.9e-23
CP000828_1498 1/1 204 271 .. 1 70 [] 78.5 1.2e-22

Alignments of top-scoring domains:
CP000828_6126: domain 1 of 1, from 1766 to 1833: score 83.6, E = 3.6e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARE+HD+++Q++++i+lqle+a+ +l pe a+ ld++
CP000828_6 1766 ERNRLAREIHDTLAQAFTGISLQLEAAKNIL--SQQPETAKSYLDQA 1810

relarealaevRrllgdLRpaal<-*
r+l +++l+e+Rr +++LR al
CP000828_6 1811 RDLTHQGLSEARRSVHALRSEAL 1833

CP000828_0477: domain 1 of 1, from 224 to 291: score 79.5, E = 5.9e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HDsvg+sL+a ++qle + + ++d ++a ++l+ +
CP000828_0 224 ERNRIAREMHDSVGHSLTAQSIQLENVDVWM--ASDRAKATDHLAKA 268

relarealaevRrllgdLRpaal<-*
r l++eal+ vR+++ +LR l
CP000828_0 269 RSLGKEALQNVRHTVATLRNNPL 291

CP000828_1498: domain 1 of 1, from 204 to 271: score 78.5, E = 1.2e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIAR +HDs+g+sL+ + ++lela+rl+ + d + ++ l+++
CP000828_1 204 ERTRIARNIHDSLGHSLTTLDVHLELAQRLY--HQDSIQTEQSLQTA 248

relarealaevRrllgdLRpaal<-*
++la+++l+evRr ++++R+ +l
CP000828_1 249 KQLAQQCLTEVRRSVQTIREETL 271


Histogram of all scores:
score obs exp (one = represents 20 sequences)
----- --- ---
-15 2 0|=
-14 159 0|========
-13 256 0|=============
-12 316 69|===*============
-11 468 573|======================== *
-10 1043 1330|===================================================== *
-9 1154 1510|==========================================================*
-8 851 1163|=========================================== *
-7 702 731|====================================*
-6 489 414|====================*====
-5 370 222|===========*=======
-4 194 115|=====*====
-3 108 59|==*===
-2 56 30|=*=
-1 42 15|*==
0 17 7|*
1 10 4|*
2 6 2|*
3 1 1|*
4 1 0|=
5 5 0|=
> 6 4 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1398.7665
P(chi-square) = 0

Total sequences searched: 6254

Whole sequence top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: