Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

1 accessions found for Salinispora arenicola CNS-205  

Data for CP000850  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000850.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000850_1734 CDS_2055778-2054486 87.9 1.6e-25 1
CP000850_4675 CDS_5517494-5516322 79.4 5.1e-23 1
CP000850_1559 CDS_1831031-1832308 71.0 1.5e-20 1
CP000850_3376 CDS_4049108-4050787 59.1 4.9e-17 1
CP000850_1489 CDS_1763112-1761391 57.9 1.1e-16 1
CP000850_0417 CDS_485438-484122 39.5 2.9e-11 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000850_1734 1/1 223 290 .. 1 70 [] 87.9 1.6e-25
CP000850_4675 1/1 184 250 .. 1 70 [] 79.4 5.1e-23
CP000850_1559 1/1 205 272 .. 1 70 [] 71.0 1.5e-20
CP000850_3376 1/1 352 419 .. 1 70 [] 59.1 4.9e-17
CP000850_1489 1/1 381 447 .. 1 70 [] 57.9 1.1e-16
CP000850_0417 1/1 240 307 .. 1 70 [] 39.5 2.9e-11

Alignments of top-scoring domains:
CP000850_1734: domain 1 of 1, from 223 to 290: score 87.9, E = 1.6e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD+v+++ s++ +q+ ++rr+l d+dp++ar+al+++
CP000850_1 223 ERVRIARELHDVVAHHVSVMGVQAAACRRVL--DRDPAKARTALAAV 267

relarealaevRrllgdLRpaal<-*
+e ar+a +e+Rr+lg+LR
CP000850_1 268 EESARTAVDELRRMLGVLRARNQ 290

CP000850_4675: domain 1 of 1, from 184 to 250: score 79.4, E = 5.1e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARELHD+v ++ +a+ +q+e+ar+l ++pe+++++l+++
CP000850_4 184 ERTRIARELHDVVTHHVTAMVVQAEAARYLS---SAPERLDQTLAAV 227

relarealaevRrllgdLRpaal<-*
+++r+a++++R+ll L p++
CP000850_4 228 SDTGRRAITDLRHLLDLLDPDDG 250

CP000850_1559: domain 1 of 1, from 205 to 272: score 71.0, E = 1.5e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD++++++s+++l++++++ + d+ p+e+++a i
CP000850_1 205 ERTRIAREMHDVLAHRISLLSLHAGALEFRP--DASPQEVARASGVI 249

relarealaevRrllgdLRpaal<-*
r+ a+ al+++R+++g+LR +
CP000850_1 250 RDSAHAALRDLREVIGVLRAETG 272

CP000850_3376: domain 1 of 1, from 352 to 419: score 59.1, E = 4.9e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARE+HD+v+Q L ++ +++ a++ + ++d +e +e l+ +
CP000850_3 352 ERQRLAREIHDGVAQELVMVGYGIDNALATV--HDDTDETAESLRLL 396

relarealaevRrllgdLRpaal<-*
r+ + + ++e+R l +LR ++
CP000850_3 397 RQEVTRVITELRLSLFELRSEVD 419

CP000850_1489: domain 1 of 1, from 381 to 447: score 57.9, E = 1.1e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+RIAR+LHD+v Q+L+a l+l+ a + +++ e++ ++ ++
CP000850_1 381 DRERIARDLHDVVIQRLFATGLHLQSAVPMS--TRP--ELANRINAA 423

relarealaevRrllgdLR.paal<-*
+ ++ +++++Rr++ +LR+p++
CP000850_1 424 VDDLDATIKDIRRTIFELRtPMTA 447

CP000850_0417: domain 1 of 1, from 240 to 307: score 39.5, E = 2.9e-11
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
+ + R++HD+ Q+L +++ l++ar +l ++dp +a +lde+
CP000850_0 240 ALRKLERDIHDGPQQRLVRLAMDLSRAREQL--ADDPVAAGHTLDEA 284

relarealaevRrllgdLRpaal<-*
+ re+l+e+R+l +++ p++l
CP000850_0 285 VGQTRETLTELRALSRGIAPPVL 307


Histogram of all scores:
score obs exp (one = represents 13 sequences)
----- --- ---
-14 5 0|=
-13 35 0|===
-12 74 54|====*=
-11 154 450|============ *
-10 397 1045|=============================== *
-9 649 1187|================================================== *
-8 682 915|===================================================== *
-7 735 575|============================================*============
-6 641 325|========================*=========================
-5 597 174|=============*================================
-4 339 91|======*====================
-3 209 46|===*=============
-2 153 23|=*==========
-1 94 12|*=======
0 61 6|*====
1 33 3|*==
2 18 1|*=
3 12 0|=
4 7 0|=
5 7 0|=
6 2 0|=
7 3 0|=
8 0 0|
> 9 10 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 5240.7407
P(chi-square) = 0

Total sequences searched: 4917

Whole sequence top hits:
tophits_s report:
Total hits: 6
Satisfying E cutoff: 6
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 6
Satisfying E cutoff: 6
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: