Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

2 accessions found for Brucella canis ATCC 23365  

Data for CP000872  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP000872.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000872_1599 CDS_1603884-1602949 146.9 3.6e-50 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000872_1599 1/1 118 200 .. 1 85 [] 146.9 3.6e-50

Alignments of top-scoring domains:
CP000872_1599: domain 1 of 1, from 118 to 200: score 146.9, E = 3.6e-50
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E++HR+KN+LA+VQSia+QT+R+++s+d+f+ +F+gR+q+Ls ++dL
CP000872_1 118 EVSHRSKNLLAIVQSIATQTARFTDSIDDFLVKFRGRIQSLSYSQDL 164

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
+t+s+W+gA + +L++++++ y + d+eR+t++G++
CP000872_1 165 --VTDSNWRGALFLDLVRSQVEKYIDIDDERLTIEGDN 200


Histogram of all scores:
score obs exp (one = represents 7 sequences)
----- --- ---
-16 1 0|=
-15 0 0|
-14 18 0|===
-13 76 0|===========
-12 244 0|===================================
-11 251 17|==*=================================
-10 308 217|==============================*=============
-9 320 538|============================================== *
-8 369 558|===================================================== *
-7 227 375|================================= *
-6 102 204|=============== *
-5 79 101|============ *
-4 48 48|======*
-3 26 22|===*
-2 15 10|=*=
-1 9 4|*=
0 3 2|*
1 1 0|=
2 1 0|=
3 1 0|=
4 0 0|
> 5 3 -|=


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 3491.0408
P(chi-square) = 0

Total sequences searched: 2102

Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: