hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP000873.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000873_0556 CDS_573639-575030 142.0 9.3e-49 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000873_0556 1/1 259 341 .. 1 85 [] 142.0 9.3e-49
Alignments of top-scoring domains:
CP000873_0556: domain 1 of 1, from 259 to 341: score 142.0, E = 9.3e-49
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E HR+KN++A+VQSia+QTlRn+ +++++++ Fs RL+ALs+aHd+
CP000873_0 259 EIAHRFKNSMAMVQSIANQTLRNTYDPEQANRLFSERLRALSQAHDM 305
VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L ++WagA++ ++++ +LaP+++ a Ri++sGP+
CP000873_0 306 --LLKENWAGATIQQICATALAPFNSTFANRIHMSGPH 341
Histogram of all scores:
score obs exp (one = represents 4 sequences)
----- --- ---
-15 3 0|=
-14 14 0|====
-13 32 0|========
-12 109 0|============================
-11 110 9|==*=========================
-10 205 118|=============================*======================
-9 193 294|================================================= *
-8 181 305|============================================== *
-7 116 205|============================= *
-6 72 111|================== *
-5 57 55|=============*=
-4 29 26|======*=
-3 15 12|==*=
-2 7 5|=*
-1 3 2|*
0 1 1|*
> 1 2 -|=
% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 1280.1204
P(chi-square) = 0
Total sequences searched: 1149
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K
