Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

3 accessions found for Rhizobium sp. NGR234  

Data for CP000874  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP000874.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000874_1545 CDS_1586472-1589195 126.7 3.1e-43 1
CP000874_0742 CDS_761708-763081 80.6 1.6e-27 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000874_1545 1/1 718 800 .. 1 85 [] 126.7 3.1e-43
CP000874_0742 1/1 268 350 .. 1 85 [] 80.6 1.6e-27

Alignments of top-scoring domains:
CP000874_1545: domain 1 of 1, from 718 to 800: score 126.7, E = 3.1e-43
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKNtLA+V+SiarQ++ +++ e++++F++R++AL+++H
CP000874_1 718 ELSHRVKNTLAIVSSIARQSFSVNPDVHEAHRSFDARIRALAQTHTR 764

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L +++W+g+ L +l eL Py++++ +tlsGP+
CP000874_1 765 --LAEASWSGVALETVLFDELTPYHDDAKNNVTLSGPP 800

CP000874_0742: domain 1 of 1, from 268 to 350: score 80.6, E = 1.6e-27
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKN L+ V ++a+ +l ++sldef+++F+ RL +Lsr++dL
CP000874_0 268 ELHHRVKNALSSVNALANRSLDESQSLDEFRDRFAIRLGSLSRTQDL 314

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L r+ + ++e+l+ eL++ gg+ +e ++l GPd
CP000874_0 315 --LMRAPEHDVLMAEVLRLELGAQGGHEGENFHLAGPD 350


Histogram of all scores:
score obs exp (one = represents 8 sequences)
----- --- ---
-14 4 0|=
-13 28 0|====
-12 165 0|=====================
-11 227 19|==*==========================
-10 369 240|=============================*=================
-9 419 595|===================================================== *
-8 417 618|===================================================== *
-7 280 415|=================================== *
-6 158 226|==================== *
-5 118 112|=============*=
-4 55 53|======*
-3 40 24|==*==
-2 22 11|=*=
-1 11 5|*=
0 5 2|*
1 4 1|*
2 0 0|
3 1 0|=
> 4 5 -|=


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 2551.2073
P(chi-square) = 0

Total sequences searched: 2328

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: