Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
14 projects found  

3 accessions found for Herpetosiphon aurantiacus ATCC 23779  

Data for CP000875  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_1.hmm [HisKA]
Sequence database: CP000875.Gprot.fsa
per-sequence score cutoff: >= 26.8 [TC1]
per-domain score cutoff: >= 26.8 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA
Accession: PF00512.12
Description: His Kinase A (phosphoacceptor) domain
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000875_4495 CDS_5784034-5782874 100.4 5.1e-28 1
CP000875_3919 CDS_4933454-4931349 96.5 6.3e-27 1
CP000875_0590 CDS_686843-684201 96.5 6.4e-27 1
CP000875_1465 CDS_1718640-1722782 94.3 2.7e-26 1
CP000875_4041 CDS_5186106-5188763 92.9 6.9e-26 1
CP000875_1138 CDS_1308260-1306365 92.6 8.2e-26 1
CP000875_4830 CDS_6185429-6182775 90.6 3e-25 1
CP000875_2131 CDS_2699207-2701474 90.5 3.1e-25 1
CP000875_4094 CDS_5261799-5251387 89.1 8.3e-25 1
CP000875_0602 CDS_696810-699167 88.2 1.5e-24 1
CP000875_3430 CDS_4333613-4335988 87.6 2.1e-24 1
CP000875_1213 CDS_1403614-1409247 85.3 9.8e-24 1
CP000875_4384 CDS_5628782-5627289 84.5 1.6e-23 1
CP000875_1825 CDS_2133548-2131839 83.8 2.6e-23 1
CP000875_4220 CDS_5409274-5406080 79.7 3.7e-22 1
CP000875_4628 CDS_5940901-5939300 79.4 4.5e-22 1
CP000875_4885 CDS_6244099-6245772 79.3 4.9e-22 1
CP000875_4239 CDS_5435462-5433048 78.1 1e-21 1
CP000875_4746 CDS_6077960-6080392 76.6 2.8e-21 1
CP000875_2784 CDS_3558775-3557303 76.4 3.3e-21 2
CP000875_0589 CDS_684185-682992 75.5 5.6e-21 1
CP000875_3442 CDS_4351453-4348577 75.1 7.3e-21 1
CP000875_4636 CDS_5949947-5952628 74.5 1.1e-20 1
CP000875_2261 CDS_2908834-2911521 73.4 2.2e-20 1
CP000875_0933 CDS_1071452-1073056 72.9 3.1e-20 1
CP000875_3006 CDS_3814273-3816168 72.5 4.2e-20 1
CP000875_4643 CDS_5961370-5962611 71.9 5.9e-20 1
CP000875_2249 CDS_2892650-2895328 71.3 8.7e-20 1
CP000875_3915 CDS_4926913-4928181 70.5 1.5e-19 1
CP000875_0799 CDS_908797-907598 69.8 2.4e-19 1
CP000875_4457 CDS_5728801-5730546 66.2 2.5e-18 1
CP000875_2345 CDS_3006370-3004994 62.4 3e-17 1
CP000875_3349 CDS_4246150-4243949 62.3 3.2e-17 2
CP000875_3374 CDS_4273123-4275171 61.8 4.5e-17 1
CP000875_1263 CDS_1477332-1478960 61.4 5.7e-17 1
CP000875_3048 CDS_3868307-3869683 60.2 1.3e-16 1
CP000875_0305 CDS_363943-366207 57.5 7.1e-16 1
CP000875_0902 CDS_1037535-1039121 57.5 7.1e-16 1
CP000875_4635 CDS_5947907-5949940 56.6 1.3e-15 1
CP000875_1437 CDS_1680213-1678483 56.3 1.6e-15 1
CP000875_1481 CDS_1737131-1738528 56.2 1.7e-15 1
CP000875_3088 CDS_3911222-3914857 55.7 2.4e-15 1
CP000875_4509 CDS_5795565-5797043 54.2 6.4e-15 1
CP000875_1899 CDS_2302397-2303860 53.2 1.2e-14 1
CP000875_2355 CDS_3016239-3014920 50.7 6e-14 1
CP000875_0447 CDS_525327-526139 49.0 1.8e-13 1
CP000875_3892 CDS_4901395-4903947 48.4 2.7e-13 2
CP000875_3505 CDS_4432572-4435640 45.6 1.7e-12 1
CP000875_0715 CDS_827601-829196 45.6 1.8e-12 1
CP000875_0848 CDS_965328-962161 44.8 2.8e-12 1
CP000875_0397 CDS_467496-468890 43.8 5.4e-12 1
CP000875_0815 CDS_927871-926690 43.3 7.6e-12 1
CP000875_2125 CDS_2687754-2690585 42.6 1.2e-11 1
CP000875_2315 CDS_2970261-2969005 41.5 2.6e-11 1
CP000875_0443 CDS_520012-522153 38.0 2.5e-10 1
CP000875_0054 CDS_69559-70764 36.9 5e-10 1
CP000875_3443 CDS_4353092-4351458 35.9 9.4e-10 1
CP000875_2509 CDS_3225503-3229087 34.5 2.4e-09 1
CP000875_2849 CDS_3633183-3634451 32.6 8.4e-09 1
CP000875_3324 CDS_4210619-4212292 29.8 5.2e-08 1
CP000875_4854 CDS_6211973-6211248 29.1 8.2e-08 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000875_4495 1/1 154 222 .. 1 87 [] 100.4 5.1e-28
CP000875_3919 1/1 460 526 .. 1 87 [] 96.5 6.3e-27
CP000875_0590 1/1 631 699 .. 1 87 [] 96.5 6.4e-27
CP000875_1465 1/1 892 960 .. 1 87 [] 94.3 2.7e-26
CP000875_4041 1/1 646 714 .. 1 87 [] 92.9 6.9e-26
CP000875_1138 1/1 397 468 .. 1 87 [] 92.6 8.2e-26
CP000875_4830 1/1 641 709 .. 1 87 [] 90.6 3e-25
CP000875_2131 1/1 256 322 .. 1 87 [] 90.5 3.1e-25
CP000875_4094 1/1 3232 3300 .. 1 87 [] 89.1 8.3e-25
CP000875_0602 1/1 538 606 .. 1 87 [] 88.2 1.5e-24
CP000875_3430 1/1 288 356 .. 1 87 [] 87.6 2.1e-24
CP000875_1213 1/1 1630 1698 .. 1 87 [] 85.3 9.8e-24
CP000875_4384 1/1 253 321 .. 1 87 [] 84.5 1.6e-23
CP000875_1825 1/1 208 274 .. 1 87 [] 83.8 2.6e-23
CP000875_4220 1/1 552 620 .. 1 87 [] 79.7 3.7e-22
CP000875_4628 1/1 303 368 .. 1 87 [] 79.4 4.5e-22
CP000875_4885 1/1 307 375 .. 1 87 [] 79.3 4.9e-22
CP000875_4239 1/1 432 498 .. 1 87 [] 78.1 1e-21
CP000875_4746 1/1 588 653 .. 1 87 [] 76.6 2.8e-21
CP000875_2784 2/2 246 313 .. 1 87 [] 75.7 4.9e-21
CP000875_0589 1/1 169 237 .. 1 87 [] 75.5 5.6e-21
CP000875_3442 1/1 734 802 .. 1 87 [] 75.1 7.3e-21
CP000875_4636 1/1 650 718 .. 1 87 [] 74.5 1.1e-20
CP000875_2261 1/1 665 733 .. 1 87 [] 73.4 2.2e-20
CP000875_0933 1/1 293 361 .. 1 87 [] 72.9 3.1e-20
CP000875_3006 1/1 395 463 .. 1 87 [] 72.5 4.2e-20
CP000875_4643 1/1 187 254 .. 1 87 [] 71.9 5.9e-20
CP000875_2249 1/1 670 738 .. 1 87 [] 71.3 8.7e-20
CP000875_3915 1/1 202 268 .. 1 87 [] 70.5 1.5e-19
CP000875_0799 1/1 158 223 .. 1 87 [] 69.8 2.4e-19
CP000875_4457 1/1 337 405 .. 1 87 [] 66.2 2.5e-18
CP000875_2345 1/1 237 301 .. 1 87 [] 62.4 3e-17
CP000875_3374 1/1 453 521 .. 1 87 [] 61.8 4.5e-17
CP000875_1263 1/1 300 364 .. 1 87 [] 61.4 5.7e-17
CP000875_3349 2/2 502 572 .. 1 87 [] 60.5 1e-16
CP000875_3048 1/1 231 295 .. 1 87 [] 60.2 1.3e-16
CP000875_0305 1/1 498 567 .. 1 87 [] 57.5 7.1e-16
CP000875_0902 1/1 303 370 .. 1 87 [] 57.5 7.1e-16
CP000875_4635 1/1 448 516 .. 1 87 [] 56.6 1.3e-15
CP000875_1437 1/1 335 403 .. 1 87 [] 56.3 1.6e-15
CP000875_1481 1/1 233 297 .. 1 87 [] 56.2 1.7e-15
CP000875_3088 1/1 978 1046 .. 1 87 [] 55.7 2.4e-15
CP000875_4509 1/1 250 318 .. 1 87 [] 54.2 6.4e-15
CP000875_1899 1/1 262 331 .. 1 87 [] 53.2 1.2e-14
CP000875_2355 1/1 220 286 .. 1 87 [] 50.7 6e-14
CP000875_0447 1/1 50 116 .. 1 87 [] 49.0 1.8e-13
CP000875_3892 1/2 485 550 .. 1 87 [] 48.1 3.3e-13
CP000875_3505 1/1 660 724 .. 1 87 [] 45.6 1.7e-12
CP000875_0715 1/1 309 374 .. 1 87 [] 45.6 1.8e-12
CP000875_0848 1/1 690 755 .. 1 87 [] 44.8 2.8e-12
CP000875_0397 1/1 251 313 .. 1 87 [] 43.8 5.4e-12
CP000875_0815 1/1 178 244 .. 1 87 [] 43.3 7.6e-12
CP000875_2125 1/1 573 641 .. 1 87 [] 42.6 1.2e-11
CP000875_2315 1/1 184 252 .. 1 87 [] 41.5 2.6e-11
CP000875_0443 1/1 344 410 .. 1 87 [] 38.0 2.5e-10
CP000875_0054 1/1 152 222 .. 1 87 [] 36.9 5e-10
CP000875_3443 1/1 314 380 .. 1 87 [] 35.9 9.4e-10
CP000875_2509 1/1 827 893 .. 1 87 [] 34.5 2.4e-09
CP000875_2849 1/1 184 252 .. 1 87 [] 32.6 8.4e-09
CP000875_3324 1/1 338 403 .. 1 87 [] 29.8 5.2e-08
CP000875_4854 1/1 17 74 .. 11 87 .] 29.1 8.2e-08

Alignments of top-scoring domains:
CP000875_4495: domain 1 of 1, from 154 to 222: score 100.4, E = 5.1e-28
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ks+fla++sHELRTPL+aI+gy+elL+e ++ ++q+
CP000875_4 154 SKSQFLAMMSHELRTPLNAIIGYSELLQE----------DAEADQL- 189

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
p+y + l+ti++++ +ll Lind+Ldls+ieag
CP000875_4 190 -------PNYVQDLSTIRNAGVHLLGLINDVLDLSKIEAG 222

CP000875_3919: domain 1 of 1, from 460 to 526: score 96.5, E = 6.3e-27
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+k+ef++ +sHELRTPLt+I+gy+elLl+ e + +r
CP000875_3 460 MKNEFVSVVSHELRTPLTSILGYTELLLA---------REFKPVER- 496

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+e+++t++++a++l+++++dlL lsr++ag
CP000875_3 497 ----------QEFVQTVYDQANQLSKMVDDLLNLSRLDAG 526

CP000875_0590: domain 1 of 1, from 631 to 699: score 96.5, E = 6.4e-27
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ks+fla++sHELRTPL+aI+g++ +Ll+el ++l e++
CP000875_0 631 LKSQFLASISHELRTPLNAIIGFSTVLLDEL-------SPLLVEEQ- 669

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
re leti + +++ll+Lind+Ld++rieag
CP000875_0 670 ----------REDLETINKNGRYLLDLINDILDMARIEAG 699

CP000875_1465: domain 1 of 1, from 892 to 960: score 94.3, E = 2.7e-26
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
k+efla++sHELRTPLt+I++++e+L+ +++ ++l+ q
CP000875_1 892 LKDEFLASMSHELRTPLTGILAFTEALRYDQY------GALNQAQ-- 930

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+++l+ i++ +++ll+Lind+Ldls+ieag
CP000875_1 931 ----------AQALQQIDENSRHLLDLINDILDLSKIEAG 960

CP000875_4041: domain 1 of 1, from 646 to 714: score 92.9, E = 6.9e-26
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+k+ef+a++sHELRTPLt+I+gy++lL + ++l+e+q
CP000875_4 646 MKTEFVATASHELRTPLTSISGYIDLLMLNT------LGPLTEQQ-- 684

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r++l+++++ +erl++++ndlLd srie+g
CP000875_4 685 ----------RQFLSVVKNNIERLNAILNDLLDVSRIESG 714

CP000875_1138: domain 1 of 1, from 397 to 468: score 92.6, E = 8.2e-26
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aks flan+sHELRTPL+aI+gy+elL + dt+ +++++
CP000875_1 397 AKSTFLANMSHELRTPLNAIIGYSELLMD--------DTDFDDPTM- 434

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ +r + i +++++ll+L+nd+Ldl++ eag
CP000875_1 435 ------VEQFRHDIAQINDAGHQLLNLVNDVLDLAKVEAG 468

CP000875_4830: domain 1 of 1, from 641 to 709: score 90.6, E = 3e-25
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
k+ef+ ++sHELRTP+t+I+gy++lL + ++ +e ++ q
CP000875_4 641 LKTEFIGTVSHELRTPMTSIKGYTQLLAM------GSLGEVNSTQ-- 679

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+e+l+ti + +er+ ++indlLd+++ie+g
CP000875_4 680 ----------KEFLNTIAHNSERMIAIINDLLDITKIETG 709

CP000875_2131: domain 1 of 1, from 256 to 322: score 90.5, E = 3.1e-25
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ks+flan+sHELRTPL+aI+ ++ L + ++e se q
CP000875_2 256 LKSRFLANMSHELRTPLNAIINFTAFLDR--------YGEFSERQ-- 292

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
re+ e++l a++ll Lind+Ldls+ieag
CP000875_2 293 ----------RELQERVLYNADHLLGLINDILDLSKIEAG 322

CP000875_4094: domain 1 of 1, from 3232 to 3300: score 89.1, E = 8.3e-25
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ak++f+a++sHELRTPLt Irg+++lLl + + ls++q
CP000875_4 3232 AKRDFVATVSHELRTPLTPIRGFVDLLLL------GAVGQLSDPQ-- 3270

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
re+l+t++ a r+ L++dlL++ r+eag
CP000875_4 3271 ----------REMLNTVKTNAMRMVGLVEDLLEIGRLEAG 3300

CP000875_0602: domain 1 of 1, from 538 to 606: score 88.2, E = 1.5e-24
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ks+flan+sHELRTPLtaI+gya++++e + l++ +++
CP000875_0 538 TKSQFLANMSHELRTPLTAIIGYADVMRE---------DLLDSNDQI 575

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
y l++i++++ +ll Lind+Ldls+ieag
CP000875_0 576 ---------YLADLDRIRSAGAHLLGLINDVLDLSKIEAG 606

CP000875_3430: domain 1 of 1, from 288 to 356: score 87.6, E = 2.1e-24
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aks flan+sHELRTPL+aI+gy+e+L+ee ++l+ +
CP000875_3 288 AKSNFLANMSHELRTPLNAIIGYSEILQEEC-------EDLGQTAM- 326

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
e l++i+ ++++ll Lind+Ldl++ie+g
CP000875_3 327 ----------IEDLDRIRLSGRHLLTLINDILDLAKIESG 356

CP000875_1213: domain 1 of 1, from 1630 to 1698: score 85.3, E = 9.8e-24
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ks flan+sHELRTPL++I+g++e++le+ + ++ ++
CP000875_1 1630 LKSAFLANMSHELRTPLNSILGFTEVILEGIN------GPINDLI-- 1668

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ l++i+r +++ll+Lind+Ld+++ie+g
CP000875_1 1669 ----------HNDLSIIHRNGRHLLNLINDILDMAKIESG 1698

CP000875_4384: domain 1 of 1, from 253 to 321: score 84.5, E = 1.6e-23
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
k++flan+sHELRTPL+aI+ +++ L + +++++l++ q+
CP000875_4 253 LKTRFLANMSHELRTPLNAIINFTQFLGK------PRYGDLTARQI- 292

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
e+ e++l +e+ll Lind+Ldls+ieag
CP000875_4 293 -----------ELQERVLVNSEHLLGLINDILDLSKIEAG 321

CP000875_1825: domain 1 of 1, from 208 to 274: score 83.8, E = 2.6e-23
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ks+fla++sHELRTPL+aI+ ++e +++ ++l+++q
CP000875_1 208 RKSQFLATMSHELRTPLNAIINMTEF-IDWF-------GPLNSQQ-- 244

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ y + ++ ++e+ll+Lind+Ldls+ieag
CP000875_1 245 ----------KSYQDQVRGAGEHLLHLINDILDLSKIEAG 274

CP000875_4220: domain 1 of 1, from 552 to 620: score 79.7, E = 3.7e-22
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
k+e++an+sHELRTPLtaI+gy+elLl+ + + l++ +
CP000875_4 552 LKEELVANMSHELRTPLTAILGYSELLLK------RRTEVLTPWH-- 590

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+e i+ ++rll+L+ndlLd+++++ag
CP000875_4 591 ----------TTKIEGIRTGGQRLLSLVNDLLDIAKLDAG 620

CP000875_4628: domain 1 of 1, from 303 to 368: score 79.4, E = 4.5e-22
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
k++f+an+sHELRTPL+ I++ya l++ + ++
CP000875_4 303 LKTQFVANASHELRTPLANIKLYARLAQQ----------VKAKTKL- 338

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+yleti +ea rl+++++dlL+l+r+++g
CP000875_4 339 ----------PQYLETIASEAGRLEAIVEDLLTLTRLDSG 368

CP000875_4885: domain 1 of 1, from 307 to 375: score 79.3, E = 4.9e-22
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aks f+a++sHELRTPL+aI+gy++lL ++ +++ e++
CP000875_4 307 AKSMFVATMSHELRTPLNAILGYTQLLHLGA-------KARGQEDV- 345

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
le+i+ ++++ll L++++Ld+s+ie+g
CP000875_4 346 ----------LPQLERIRLAGKHLLTLVSNVLDFSKIEHG 375

CP000875_4239: domain 1 of 1, from 432 to 498: score 78.1, E = 1e-21
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a ++++a+++HEL++P+t+I+g+aelLl+ + +l+++
CP000875_4 432 AIGQLVAGVAHELNNPMTSIKGFAELLLR--------RKDLDDDA-- 468

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r l+ i ++aer r++ +lL+++r ++
CP000875_4 469 ----------RTDLNYINNQAERAARIVTNLLTFAREHQP 498

CP000875_4746: domain 1 of 1, from 588 to 653: score 76.6, E = 2.8e-21
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++++ ++ H+L++PLt+I+ y++lL++ ++l+e q
CP000875_4 588 LREQMNQMVVHDLKNPLTVIINYLDLLRR---------QALPESQ-- 623

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
re++e ++r+++ l L++dlLd +r+++g
CP000875_4 624 ----------RELVEGARRSSRTLVGLVSDLLDTARLQEG 653

CP000875_2784: domain 2 of 2, from 246 to 313: score 75.7, E = 4.9e-21
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ +++a++sHELRTPL+a+rg++e+L++++ +++e +
CP000875_2 246 TQKRLTADVSHELRTPLAAMRGNLEVLRRGA--------MRNPELL- 283

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
e l+ ++re+ rl+rL+ndlL l++ eag
CP000875_2 284 ----------NESLSDLEREVARLNRLVNDLLFLAQTEAG 313

CP000875_0589: domain 1 of 1, from 169 to 237: score 75.5, E = 5.6e-21
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ak++fla++sHELRTPLt+I gy++lL +++ ++ s+ q
CP000875_0 169 AKNDFLATISHELRTPLTVIHGYIDLLNMQA------LGPVSDGQ-- 207

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
re+le ++r + rllr indl l + +++
CP000875_0 208 ----------REALELMKRNSTRLLRHINDLIYLQQVRSN 237

CP000875_3442: domain 1 of 1, from 734 to 802: score 75.1, E = 7.3e-21
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ks+f++++sH+L+ PLtaI+gya+l + ++ ++ +e q
CP000875_3 734 IKSRFVSMVSHDLKSPLTAIQGYAQLVAD------GHMGTVNEMQ-- 772

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r++l+ + r + + +Li+dlLdl +ieag
CP000875_3 773 ----------RDALQAVVRNTGAMTALISDLLDLGKIEAG 802

CP000875_4636: domain 1 of 1, from 650 to 718: score 74.5, E = 1.1e-20
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ak++f+a++sHELRTPLt+I gya+lLl+ + ++l++eq
CP000875_4 650 AKTDFIATISHELRTPLTSICGYADLLLR------GFVGPLTDEQ-- 688

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ +ti+++++++ + ++++ ++ ieag
CP000875_4 689 ----------TQFMSTIRQQGQSMVEVLQNVIVIASIEAG 718

CP000875_2261: domain 1 of 1, from 665 to 733: score 73.4, E = 2.2e-20
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++ +l+++sH+LRTPL+aI+g+a++Ll+ t++ +++++
CP000875_2 665 MRNSLLSSVSHDLRTPLAAISGAASTLLD--------QTNQLDQHIQ 703

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+e+++ti +e++rl+rL+++lLd++r+eag
CP000875_2 704 ----------HELIQTIADEGQRLNRLLSNLLDMTRLEAG 733

CP000875_0933: domain 1 of 1, from 293 to 361: score 72.9, E = 3.1e-20
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++s f++ +sHEL+TP++ I+gya++L + d +l+ ++
CP000875_0 293 QQSTFISVMSHELKTPVAIIKGYASTLSR-------TDVKLNKATK- 331

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+e+l i++ea+rl rLi dlL+ sr++ag
CP000875_0 332 ----------AEMLTGIEEEADRLARLIGDLLEVSRMQAG 361

CP000875_3006: domain 1 of 1, from 395 to 463: score 72.5, E = 4.2e-20
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ks f++++sHELRTPL+aI+gy+elL ++l ++ + +q
CP000875_3 395 SKSTFMSMMSHELRTPLNAIIGYSELLIDDL-------SATNQQQS- 433

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ + i++++++ll+ i+ +L+ s +e+g
CP000875_3 434 ----------TDDARQIRSAGRHLLHVIETILQVSNLESG 463

CP000875_4643: domain 1 of 1, from 187 to 254: score 71.9, E = 5.9e-20
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++++++a++sH+LRTPLta+r+++e+L + + +e+ ++
CP000875_4 187 SRRDLIAAISHDLRTPLTAVRAMIEALAD---------GVVTEPAMQ 224

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++yl+++ +++ l+ L++dl ++++++ag
CP000875_4 225 ----------QRYLNSANSQLTNLSTLVDDLFEMAQLDAG 254

CP000875_2249: domain 1 of 1, from 670 to 738: score 71.3, E = 8.7e-20
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
k+ +la++ HELRTPL+aI+g+a++Ll d ++ ++
CP000875_2 670 FKTTLLAAVGHELRTPLAAIKGNASTLLQ-------DDIVWPLAEQ- 708

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r +l+ti +ea+rl +++ +lLd+sr eag
CP000875_2 709 ----------RHFLSTISSEADRLASMVTNLLDISRFEAG 738

CP000875_3915: domain 1 of 1, from 202 to 268: score 70.5, E = 1.5e-19
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++ f+an+sHELR PLt +r+ +e++l+ +++ ++eq
CP000875_3 202 RQQAFIANASHELRAPLTLMRASSEIALR--------ESTDPAEQ-- 238

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+e+le il e+ ++ rL++dlL lsr++a
CP000875_3 239 ----------QELLEDILAETYHMARLVEDLLLLSRLDAA 268

CP000875_0799: domain 1 of 1, from 158 to 223: score 69.8, E = 2.4e-19
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a+++++an+sHELRTPL++I++++e+L + ++ +e
CP000875_0 158 ARRDLVANVSHELRTPLASIKLLVETLAT---------QPPPELA-- 193

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+++l ++ e++ +L+++l +ls+ie+g
CP000875_0 194 ----------QRMLGQVDTELDAVMQLVDELHELSQIESG 223

CP000875_4457: domain 1 of 1, from 337 to 405: score 66.2, E = 2.5e-18
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aks fl+++sHELRTPL+aI gy+e++ e+l ++s +++
CP000875_4 337 AKSTFLSTVSHELRTPLNAIVGYSEMIYEDL-------IDRSMPEL- 375

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ +i+++++rll+Li+ +L+++ ++a+
CP000875_4 376 ----------AMDMTRIRSASDRLLSLIDGVLTITDLDAE 405

CP000875_2345: domain 1 of 1, from 237 to 301: score 62.4, E = 3e-17
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ +++a+l+H+LRTPL+ +rgyae L++ + l + +
CP000875_2 237 LRKQMTADLAHDLRTPLSILRGYAEGLRD---------GVLQPSE-- 272

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ +i +e+ +l+rL++dl+ ls ++ag
CP000875_2 273 -----------TIYTVIFDEVTHLQRLVDDLRVLSLADAG 301

CP000875_3374: domain 1 of 1, from 453 to 521: score 61.8, E = 4.5e-17
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++ la++sHE+RTPL+a ++ +elLl++l + ls q+
CP000875_3 453 LRDTILATISHEFRTPLSAQLASLELLLDQL-------PQLSTAQI- 491

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r+++ +++r a rl Li++lL+ +rieag
CP000875_3 492 ----------RQLIVSLQRGALRLTYLIDNLLESARIEAG 521

CP000875_1263: domain 1 of 1, from 300 to 364: score 61.4, E = 5.7e-17
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ksef++ sHELRTPL++++gy +++e +se+ +
CP000875_1 300 LKSEFISITSHELRTPLAVVLGYGIVIQE-----------RSEPPI- 334

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r yl+++ ++a+r+ ++i+d+ l r+++
CP000875_1 335 ----------RTYLDRLVESAQRMKEIIDDMTHLRRLDTR 364

CP000875_3349: domain 2 of 2, from 502 to 572: score 60.5, E = 1e-16
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++ fl+ +sHEL++PLt+++g ++l l++l+ + +l +e +
CP000875_3 502 LRDVFLSIASHELKNPLTTLLGQSQLSLRRLE-----RLNLVDERL- 542

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ l+ i+ +a r+++++ lLd srie+g
CP000875_3 543 ----------QRSLQAIEAQASRMNKMVTALLDVSRIETG 572

CP000875_3048: domain 1 of 1, from 231 to 295: score 60.2, E = 1.3e-16
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++++a+++HELRTPL++++ +e +++++ ++ ++
CP000875_3 231 VRRQMVADIAHELRTPLSVLQIELESIEDGV-------SKPTPAV-- 268

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++++ +e+++l++Li+dl++ls ++ag
CP000875_3 269 -------------ISSLGEEVQQLNHLIEDLRTLSLADAG 295

CP000875_0305: domain 1 of 1, from 498 to 567: score 57.5, E = 7.1e-16
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ak+efla ++HELR PL+aI+gy++lLl+ ++ ++ +e
CP000875_0 498 AKDEFLAVAAHELRSPLAAIKGYSDLLLR-------RELKQASEG-- 535

peLRledpeyreyle..tilreaerllrLindlLdlsrieag<-*
r++ t+ ++++ + +L+++lLd sri+a+
CP000875_0 536 ----------RDLRGfiTLSQQVNIMVQLVDNLLDVSRIDAE 567

CP000875_0902: domain 1 of 1, from 303 to 370: score 57.5, E = 7.1e-16
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++ ++a++sHELRTP++++rgy+e l te+ +
CP000875_0 303 DRRALVASVSHELRTPVATLRGYLESSLQ---------TEQALAPQ- 339

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+++ l +++re+ rl++Li+dl ls e g
CP000875_0 340 ---------VQRDLLVMERETLRLQQLIEDLFLLSASEVG 370

CP000875_4635: domain 1 of 1, from 448 to 516: score 56.6, E = 1.3e-15
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++ + +l H+LR PLtaI+ + ++++ ++ +++q
CP000875_4 448 IREDYMGMLVHDLRAPLTAIINGMTMVRRGFA------GPINDQQ-- 486

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
re+l+++ ++++ + +in lLd+s++eag
CP000875_4 487 ----------RELLDIANNSSQEMVGMINTLLDISKMEAG 516

CP000875_1437: domain 1 of 1, from 335 to 403: score 56.3, E = 1.6e-15
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++s f+a+++H+L++ Lt+++g+++l ++l +++++s +
CP000875_1 335 ERSNFIASVAHDLKNALTTVIGTTQLGMRKL-----RRGDQSYSE-- 374

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++++ti +++ l+Li+d+ d sr+e+g
CP000875_1 375 -----------KAFSTIATKSQQALQLIEDMVDVSRLEQG 403

CP000875_1481: domain 1 of 1, from 233 to 297: score 56.2, E = 1.7e-15
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++++++a+l+H++RTPL+ +r y+e L++ +++++
CP000875_1 233 QRQQMTADLAHDIRTPLSILRSYTEGLKD--------QRFVGSPTI- 270

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+++++e+e+l+rL++dl+ ls ++ag
CP000875_1 271 -------------YNVLHEEVEHLQRLVEDLRVLSLADAG 297

CP000875_3088: domain 1 of 1, from 978 to 1046: score 55.7, E = 2.4e-15
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ +++ ++ H+LR PL+++++ +++L +++ ++lse q
CP000875_3 978 LRHDLTYMMIHDLRGPLSSVMTSLDMLAKKM------VGDLSEGQ-- 1016

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++++++lr++ rll+++n l+d+s++eag
CP000875_3 1017 ----------DKIVKIALRSSARLLDMVNLLMDISKLEAG 1046

CP000875_4509: domain 1 of 1, from 250 to 318: score 54.2, E = 6.4e-15
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+s+f+a ++HELR PLt+Irg+a++Ll ++ s+e++
CP000875_4 250 LRSDFMALAAHELRSPLTSIRGFADMLLW------SNPEHFSAEEI- 289

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
y+e i r ++rl +L nd+ +l+r+e++
CP000875_4 290 -----------SYIEGIGRNIQRLTELMNDVVELARLETQ 318

CP000875_1899: domain 1 of 1, from 262 to 331: score 53.2, E = 1.2e-14
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++ +a++ H+L++PLt+Irg a+lLl+++ + +++se +
CP000875_1 262 DRDNAIATIVHDLKNPLTTIRGSADLLLRRA-----KTENRSERE-- 301

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
l++i+ +++r+++ ++ l d +ri ag
CP000875_1 302 ----------LNRLQSIIAQSDRMRDYLSLLVDVARINAG 331

CP000875_2355: domain 1 of 1, from 220 to 286: score 50.7, E = 6e-14
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a+++++ +l+HE R+PL ++r++++lL + +l+ + +l
CP000875_2 220 ALGQLAGGLAHEARNPLGVVRATSQLLGT----------KLTQQPNL 256

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ y+++i +e++rl+rLi+ lLd++ +a
CP000875_2 257 ----------ASYTSVINSEVDRLDRLISSLLDYAHPQAL 286

CP000875_0447: domain 1 of 1, from 50 to 116: score 49.0, E = 1.8e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ + f+ +lsHELRTPLta+++++ + + + + r
CP000875_0 50 QHRAFIGTLSHELRTPLTALLAHTAIVHN---------QQSEPAVR- 86

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ l t++rea+r+ rL++dlL+l r+e
CP000875_0 87 ----------EHSLLTLEREAQRMARLVRDLLELHRLELS 116

CP000875_3892: domain 1 of 2, from 485 to 550: score 48.1, E = 3.3e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a++e+++++ H++++ L++I+g++++L + +++eq
CP000875_3 485 ALGELASGVTHDFNNLLAGILGNVQVLMG---------ELQNPEQ-- 520

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
re l++i+r+a+ + + ++ ++r + g
CP000875_3 521 ----------RETLRVIERAAKDGAETVKRIQRFARKDDG 550

CP000875_3505: domain 1 of 1, from 660 to 724: score 45.6, E = 1.7e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a++e+ ++++H++++ +++I+g+++lLl e++eeq
CP000875_3 660 ALGELSSGIAHDFNNLIAGILGHTQLLLI----------EAPEEQ-- 694

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
re l +i+++a+ +++++++ +++r++++
CP000875_3 695 ----------REGLAVIEQAARDGRHMVERIQQFTRAQQP 724

CP000875_0715: domain 1 of 1, from 309 to 374: score 45.6, E = 1.8e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++ f+ +l H+LR PL+++ g ++L + t l+++
CP000875_0 309 SRDSFIQMLTHDLRAPLAGMVGCFDALMT---------TQLDDDG-- 344

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ ++e r++ +rLi+dlLd ++eag
CP000875_0 345 ----------KLFVELGFRAGAAQQRLIDDLLDVYKAEAG 374

CP000875_0848: domain 1 of 1, from 690 to 755: score 44.8, E = 2.8e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a+++++++++H++++ L++I+g+a+ Ll +e +++
CP000875_0 690 ALGQLASGVAHDFNNLLASILGNAQFLLI---------HEDDADR-- 725

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r++l++i+r+a+ ++++ +++r+ +
CP000875_0 726 ----------RDALQVIERAAKDGAVTVRRIQEFARASET 755

CP000875_0397: domain 1 of 1, from 251 to 313: score 43.8, E = 5.4e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a+++f +++sHELRTP+ a+ gy+e +++ +e +eq
CP000875_0 251 AQRRFYRDVSHELRTPMMALGGYLENIED---------AENADEQ-- 286

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ ++ ++ e+ rl rL ++l r +a+
CP000875_0 287 ----------AQSIRAMQAEIARLARLADEL---LRSDAQ 313

CP000875_0815: domain 1 of 1, from 178 to 244: score 43.3, E = 7.6e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a +++ a+++HE+++PL a r ++ lL+e +l+ee r
CP000875_0 178 AVGQLSASIAHEINNPLYAARNALLLLEE----------DLPEEVRE 214

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ +++++ r+ +i++++d+ r g
CP000875_0 215 ----------STVMQLARDQLTRIAGIIERMRDFYRPMRG 244

CP000875_2125: domain 1 of 1, from 573 to 641: score 42.6, E = 1.2e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a ++++ +++H++++ Lt+I+g ++lL++ r+
CP000875_2 573 AIGQLTGGIAHDFNNILTSILGGLDLLQR----------------RI 603

peLR...ledpeyreyletilreaerllrLindlLdlsrieag<-*
+ +R ++ ++y+++++++a+r +L ++lL +sr +a
CP000875_2 604 NVGRfdtI-----ERYINSAIKSAKRAAALTQRLLAFSRQQAL 641

CP000875_2315: domain 1 of 1, from 184 to 252: score 41.5, E = 2.6e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ e+ ++H++R+PL+ ++g++elL+ d+ l+++++l
CP000875_2 184 SVAELNQIVAHDIRNPLHFLQGTLELLQG--------DPLLPADHAL 222

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+l +++++ +++rL++dl d + + +g
CP000875_2 223 ----------GSLLPQAYNSVLHIQRLVRDLVDGTALMTG 252

CP000875_0443: domain 1 of 1, from 344 to 410: score 38.0, E = 2.5e-10
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ ++++ +++H++++ LtaI+gy+ l+ + +++ +
CP000875_0 344 SIGRLAGGVAHDFNNLLTAISGYTTLAID---------SAQQGFPV- 380

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
e l i+++++r L ++lL+++r ++
CP000875_0 381 ----------VEELTEIQHATDRAAMLTSQLLTFARKQQI 410

CP000875_0054: domain 1 of 1, from 152 to 222: score 36.9, E = 5e-10
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++++ l + HE+ TPL+ ++gy++l ++++ a+++ + +
CP000875_0 152 QLEQNLDVAIHEIQTPLSILLGYIQLFERRV----ASWGGIPLRE-- 192

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r++l+t++ ++ +++rL+ lLd +++ ++
CP000875_0 193 ----------RQMLNTMRLQTIHISRLVGILLDSTQMATN 222

CP000875_3443: domain 1 of 1, from 314 to 380: score 35.9, E = 9.4e-10
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++++a+l+HE+++PL+ Ir +el ++ + +
CP000875_3 314 GMGRMAASLAHEINNPLAIIRSGLELVAQ---------QHTPGTAL- 350

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++++ +++e+ r+ rL+ l + + +
CP000875_3 351 ----------GDLVQGLDEEVARIARLLYTLVNFYQPNND 380

CP000875_2509: domain 1 of 1, from 827 to 893: score 34.5, E = 2.4e-09
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a++ ++ +++H++++ L aI g+++l+ +l++++
CP000875_2 827 ALGTLAGGIAHDFNNILLAITGNTQLAMF----------DLDPQHP- 862

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ l+ i++++er +L++++L++sr ++
CP000875_2 863 ---------VQNNLREIEQAGERATDLVRRILTFSRQQEV 893

CP000875_2849: domain 1 of 1, from 184 to 252: score 32.6, E = 8.4e-09
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+k+ ++a +s +L PL++I++ ++lL ++l e++ ++
CP000875_2 184 SKTPLIAKMSQQLHKPLHTIMTDSQLLADQL-------IEAGVAEL- 222

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ + i++ + +ll+Li+d+ dl++ie+g
CP000875_2 223 ----------EPTAHHIQETSAQLLALIDDMIDLAKIEHG 252

CP000875_3324: domain 1 of 1, from 338 to 403: score 29.8, E = 5.2e-08
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++s++l l ++ PL++++++ ++Ll+ ++l++
CP000875_3 338 MRSQLLDFLVQDMHDPLNSVLAAQDTLLA---------GDLGDGN-- 373

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ l+t++r + rl +L n l+++sr+
CP000875_3 374 ----------ERVLSTARRTTSRLVELTNTLMEMSRLHGD 403

CP000875_4854: domain 1 of 1, from 17 to 74: score 29.1, E = 8.2e-08
*->HELRTPLtaIrgyaelLleeldkvlagdtelseeqrlpeLRledpey
HELRT Lt I++ ++lL d+ ++
CP000875_4 17 HELRTSLTLIQTCTDLLMH-------ADQIGQADL------------ 44

reyletilreaerllrLindlLdlsrieag<-*
r +l++i+r + r++rL++d l++ e g
CP000875_4 45 RNFLQIIRRGGTRIDRLVRDYILLAKGEYG 74


Histogram of all scores:
score obs exp (one = represents 17 sequences)
----- --- ---
-14 5 0|=
-13 38 3|*==
-12 174 113|======*====
-11 398 589|======================== *
-10 775 1094|============================================== *
-9 950 1130|======================================================== *
-8 884 846|=================================================*==
-7 637 533|===============================*======
-6 421 306|=================*=======
-5 259 168|=========*======
-4 153 90|=====*===
-3 86 47|==*===
-2 56 24|=*==
-1 30 13|*=
0 11 6|*
1 13 3|*
2 12 1|*
3 1 0|=
4 1 0|=
5 2 0|=
> 6 70 -|=====


% Statistical details of theoretical EVD fit:
mu = -8.9758
lambda = 0.6525
chi-sq statistic = 467.4953
P(chi-square) = 0

Total sequences searched: 4976

Whole sequence top hits:
tophits_s report:
Total hits: 61
Satisfying E cutoff: 61
Total memory: 22K

Domain top hits:
tophits_s report:
Total hits: 61
Satisfying E cutoff: 61
Total memory: 45K


Acknowledgements:

This research is funded by:

Developed by: