Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
14 projects found  

3 accessions found for Herpetosiphon aurantiacus ATCC 23779  

Data for CP000875  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000875.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000875_1101 CDS_1266835-1265195 89.3 6e-26 1
CP000875_2715 CDS_3485642-3487639 88.1 1.4e-25 1
CP000875_1592 CDS_1858326-1856581 80.6 2.3e-23 1
CP000875_1304 CDS_1518697-1519842 71.4 1.1e-20 1
CP000875_4466 CDS_5745382-5743634 68.5 8e-20 1
CP000875_0707 CDS_818338-817325 65.1 8.4e-19 1
CP000875_3759 CDS_4745007-4746653 62.3 5.6e-18 1
CP000875_0598 CDS_691823-693577 61.6 8.7e-18 1
CP000875_4874 CDS_6234756-6233203 61.2 1.2e-17 1
CP000875_4888 CDS_6249913-6248870 58.5 7.1e-17 1
CP000875_2158 CDS_2750805-2752121 58.4 7.8e-17 1
CP000875_0978 CDS_1124779-1125819 57.3 1.7e-16 1
CP000875_4687 CDS_6014131-6015702 54.1 1.4e-15 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000875_1101 1/1 340 407 .. 1 70 [] 89.3 6e-26
CP000875_2715 1/1 468 535 .. 1 70 [] 88.1 1.4e-25
CP000875_1592 1/1 372 439 .. 1 70 [] 80.6 2.3e-23
CP000875_1304 1/1 183 251 .. 1 70 [] 71.4 1.1e-20
CP000875_4466 1/1 360 427 .. 1 70 [] 68.5 8e-20
CP000875_0707 1/1 138 205 .. 1 70 [] 65.1 8.4e-19
CP000875_3759 1/1 336 403 .. 1 70 [] 62.3 5.6e-18
CP000875_0598 1/1 379 446 .. 1 70 [] 61.6 8.7e-18
CP000875_4874 1/1 319 386 .. 1 70 [] 61.2 1.2e-17
CP000875_4888 1/1 144 211 .. 1 70 [] 58.5 7.1e-17
CP000875_2158 1/1 239 306 .. 1 70 [] 58.4 7.8e-17
CP000875_0978 1/1 138 203 .. 1 70 [] 57.3 1.7e-16
CP000875_4687 1/1 319 386 .. 1 70 [] 54.1 1.4e-15

Alignments of top-scoring domains:
CP000875_1101: domain 1 of 1, from 340 to 407: score 89.3, E = 6e-26
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+AR+LHDsv+Q L+++++ + +ar ll ++ p++ar +++++
CP000875_1 340 ERNRLARDLHDSVSQELFSVTMLAAAARNLL--PAQPDKARSQVEQL 384

relarealaevRrllgdLRpaal<-*
++a++al e+R l+ +LRpaal
CP000875_1 385 SQMAQRALHETRGLIFALRPAAL 407

CP000875_2715: domain 1 of 1, from 468 to 535: score 88.1, E = 1.4e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R+ARELHDsv Q+L++++l +e+ar+++ +++p +a++++d++
CP000875_2 468 ERSRLARELHDSVTQTLFSMTLTAEAARAQV--ERNPVRAATQIDRL 512

relarealaevRrllgdLRpaal<-*
+++a+++l e+R+ll +LRp+ l
CP000875_2 513 KAAAHQSLGEMRELLLQLRPTPL 535

CP000875_1592: domain 1 of 1, from 372 to 439: score 80.6, E = 2.3e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+AR++HD+++Q+L++i +ql++ +r+l p e ++l+ +
CP000875_1 372 ERTRLARDIHDTLAQGLTGIVIQLGATQRAL--VYSPSESSTHLALA 416

relarealaevRrllgdLRpaal<-*
++arealae+R+ +++LR + l
CP000875_1 417 SRMAREALAEARASVWNLRAPLL 439

CP000875_1304: domain 1 of 1, from 183 to 251: score 71.4, E = 1.1e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD+++Q+L+a+ lqle+a +l++ + + e+ r+ ++++
CP000875_1 183 ERNRIAREIHDTLAQGLTAVLLQLETADALFE-TGATERGRAKIQQA 228

relarealaevRrllgdLRpaal<-*
+ r l+e+Rr + dLR a l
CP000875_1 229 LQWTRYNLDEARRSVLDLRAAPL 251

CP000875_4466: domain 1 of 1, from 360 to 427: score 68.5, E = 8e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+AR+LHDsv Q++++i+l ++++ + ++dp+e ++++ ++
CP000875_4 360 ERQRLARDLHDSVTQMIFSITLISQTVTSAW--QRDPAEGERRVNRL 404

relarealaevRrllgdLRpaal<-*
el++ alae+R ll+dL+p +
CP000875_4 405 IELSQLALAEMRSLLTDLHPIER 427

CP000875_0707: domain 1 of 1, from 138 to 205: score 65.1, E = 8.4e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R+ARE HD+ +Q L+ + ++le a + l+ +++ ++++ l+e+
CP000875_0 138 ERLRLAREVHDGPAQVLANVLMGLEHA-MNLH-QSNSPQIEPFLHEL 182

relarealaevRrllgdLRpaal<-*
r +ar++l evR + dLRp+al
CP000875_0 183 RSAARQGLHEVRGFIADLRPGAL 205

CP000875_3759: domain 1 of 1, from 336 to 403: score 62.3, E = 5.6e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+ I R+LHD+ Qs +ai++ +e +++l+ ++ pe+++++l +
CP000875_3 336 VRHQINRDLHDGPTQSVAAIAMNIEFIKKLM--QAMPERVEDELNSL 380

relarealaevRrllgdLRpaal<-*
++l++++++e+R ll +LRp +l
CP000875_3 381 AALVKKTYQELRTLLFELRPLGL 403

CP000875_0598: domain 1 of 1, from 379 to 446: score 61.6, E = 8.7e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+ +AR+LHD+ +Qs +ai++ +e ++rll +++p ++ ++l+ +
CP000875_0 379 VRQQLARDLHDGPAQSVAAITMNIEFVKRLL--EREPSRVMQELTKM 423

relarealaevRrllgdLRpaal<-*
elar++ ++R ll +LRp +l
CP000875_0 424 GELARRTTYDIRTLLFELRPLTL 446

CP000875_4874: domain 1 of 1, from 319 to 386: score 61.2, E = 1.2e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+AR+ HD+++Q+L++++lq+e+ r l pe+a+ +l+ +
CP000875_4 319 ERNRLARDFHDTLAQQLTGLRLQIEAGMRNL---HQPEKAQLRLQKA 362

relarealaevRrllgdLR.paal<-*
+la al ++Rr +++L pa++
CP000875_4 363 YDLALAALHDLRRSVWNLSaPAID 386

CP000875_4888: domain 1 of 1, from 144 to 211: score 58.5, E = 7.1e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RI+ +HD+ +Qs+s + l +e ++r l d d +ar ++ +
CP000875_4 144 ERLRISLQMHDGPAQSMSNLVLRAEICERFL--DHDTNQARSEMSSL 188

relarealaevRrllgdLRpaal<-*
++++++ l+++Rr + dLRp++l
CP000875_4 189 KTAINTVLQDTRRFIFDLRPMTL 211

CP000875_2158: domain 1 of 1, from 239 to 306: score 58.4, E = 7.8e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrllds.dkdpeearealde
ER+R ARELHD+++++Ls++++qle+a+ +++ +p + d
CP000875_2 239 ERNRVARELHDTLAHALSGLIVQLEAAK---LYrEIEPTTSHKLQDS 282

irelarealaevRrllgdLRpaal<-*
+ ++ar++l+e+R +l +LR l
CP000875_2 283 ALDAARHGLQETRLALKALRARPL 306

CP000875_0978: domain 1 of 1, from 138 to 203: score 57.3, E = 1.7e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARELHD +Q+L+ + + +e+a++ ++ ++re+l +
CP000875_0 138 ERRRIARELHDDTAQALATLVIYAETAAQNP--QAQ--AVRERLIGL 180

relarealaevRrllgdLRpaal<-*
r+la ++l+ vR ++ dLRp++l
CP000875_0 181 RDLAGTTLEGVRTIIADLRPSQL 203

CP000875_4687: domain 1 of 1, from 319 to 386: score 54.1, E = 1.4e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ +ARELHD v Q L +++ ++ +r ++ +dpe+a ld +
CP000875_4 319 ERKVLARELHDQVIQDLVSLNYDIDNLRSQI---DDPEQASLGLDDL 362

relarealaevRrllgdLR.paal<-*
r+ +r+ + vR++ g+LR+p+++
CP000875_4 363 RDNIRQLVSTVRAICGNLRpPTID 386


Histogram of all scores:
score obs exp (one = represents 15 sequences)
----- --- ---
-14 6 0|=
-13 54 0|====
-12 107 55|===*====
-11 204 456|============== *
-10 639 1058|=========================================== *
-9 865 1201|==========================================================*
-8 777 926|==================================================== *
-7 680 582|======================================*=======
-6 513 329|=====================*=============
-5 473 176|===========*====================
-4 269 92|======*===========
-3 159 47|===*=======
-2 81 24|=*====
-1 51 12|*===
0 30 6|*=
1 16 3|*=
2 15 1|*
3 6 0|=
4 7 0|=
5 5 0|=
6 1 0|=
7 1 0|=
8 0 0|
9 2 0|=
10 1 0|=
> 11 14 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 2030.7905
P(chi-square) = 0

Total sequences searched: 4976

Whole sequence top hits:
tophits_s report:
Total hits: 13
Satisfying E cutoff: 13
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 13
Satisfying E cutoff: 13
Total memory: 25K


Acknowledgements:

This research is funded by:

Developed by: