hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000887.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000887_0317 CDS_369912-371279 77.1 9.7e-23 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000887_0317 1/1 250 317 .. 1 70 [] 77.1 9.7e-23
Alignments of top-scoring domains:
CP000887_0317: domain 1 of 1, from 250 to 317: score 77.1, E = 9.7e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaR+ARELHD+++Q+L +++ ++la r++ ++ + a ++++ +
CP000887_0 250 ERARLARELHDGISQNLVGVRYAIDLASRQV--RTGSGGAPQTIEKA 294
relarealaevRrllgdLRpaal<-*
++++ a++evRrl +dLRp +l
CP000887_0 295 SDALNGAIKEVRRLSHDLRPRIL 317
Histogram of all scores:
score obs exp (one = represents 6 sequences)
----- --- ---
-14 17 0|===
-13 44 0|========
-12 69 21|===*========
-11 97 180|================= *
-10 284 418|================================================ *
-9 338 475|========================================================= *
-8 301 366|=================================================== *
-7 245 230|======================================*==
-6 185 130|=====================*=========
-5 157 69|===========*===============
-4 82 36|=====*========
-3 56 18|==*=======
-2 32 9|=*====
-1 35 4|*=====
0 7 2|*=
1 7 1|*=
2 3 0|=
3 5 0|=
4 0 0|
5 0 0|
> 6 3 -|=
% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 549.1735
P(chi-square) = 0
Total sequences searched: 1967
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K