hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP000887.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000887_1484 CDS_1621272-1620265 146.9 3.3e-50 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000887_1484 1/1 142 224 .. 1 85 [] 146.9 3.3e-50
Alignments of top-scoring domains:
CP000887_1484: domain 1 of 1, from 142 to 224: score 146.9, E = 3.3e-50
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E++HR+KN+LA+VQSia+QT+R+++s+d+f+ +F+gR+q+Ls ++dL
CP000887_1 142 EVSHRSKNLLAIVQSIATQTARFTDSIDDFLVKFRGRIQSLSYSQDL 188
VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
+t+s+W+gA + +L++++++ y + d+eR+t++G++
CP000887_1 189 --VTDSNWRGALFLDLVRSQVEKYIDIDDERLTIEGDN 224
Histogram of all scores:
score obs exp (one = represents 7 sequences)
----- --- ---
-14 19 0|===
-13 48 0|=======
-12 195 0|============================
-11 220 16|==*=============================
-10 303 203|============================*===============
-9 303 503|============================================ *
-8 362 522|==================================================== *
-7 225 351|================================= *
-6 104 191|=============== *
-5 77 94|=========== *
-4 48 45|======*
-3 30 20|==*==
-2 16 9|=*=
-1 9 4|*=
0 2 2|*
1 1 0|=
2 1 0|=
3 1 0|=
4 0 0|
> 5 3 -|=
% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 2862.1265
P(chi-square) = 0
Total sequences searched: 1967
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K