Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

1 accessions found for Methylobacterium extorquens PA1  

Data for CP000908  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP000908.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000908_4022 CDS_4539344-4542031 113.3 5.8e-32 1
CP000908_4812 CDS_5446743-5445697 109.2 8.2e-31 1
CP000908_4465 CDS_5056886-5055741 106.4 5e-30 1
CP000908_3978 CDS_4493177-4492077 90.6 1.7e-25 1
CP000908_1864 CDS_2116314-2115151 72.3 2.5e-20 1
CP000908_0429 CDS_482585-481506 69.7 1.4e-19 1
CP000908_4122 CDS_4653170-4654186 68.6 3e-19 1
CP000908_3238 CDS_3641305-3640241 40.9 2.2e-11 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000908_4022 1/1 705 788 .. 1 94 [] 113.3 5.8e-32
CP000908_4812 1/1 156 242 .. 1 94 [] 109.2 8.2e-31
CP000908_4465 1/1 191 272 .. 1 94 [] 106.4 5e-30
CP000908_3978 1/1 172 258 .. 1 94 [] 90.6 1.7e-25
CP000908_1864 1/1 191 278 .. 1 94 [] 72.3 2.5e-20
CP000908_0429 1/1 157 240 .. 1 94 [] 69.7 1.4e-19
CP000908_4122 1/1 142 224 .. 1 94 [] 68.6 3e-19
CP000908_3238 1/1 163 211 .. 1 54 [. 40.9 2.2e-11

Alignments of top-scoring domains:
CP000908_4022: domain 1 of 1, from 705 to 788: score 113.3, E = 5.8e-32
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EI HRVKN+LQ++++ L +Q r++ d+e+ + a+ E+ RV+S
CP000908_4 705 EIDHRVKNSLQIVTAFLHMQRRQIADPEA-----RQAFSETSARVMS 746

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A +H+ LY++e++++vd+++ ++ L+++L +g++ + ++ l
CP000908_4 747 VARVHDSLYQGESMEQVDLGQTIQTLCSDLAGMAGDEHS---VE--L 788

CP000908_4812: domain 1 of 1, from 156 to 242: score 109.2, E = 8.2e-31
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E++HRV N+L ++++L r+Q+ ++d+++ ++aL+E q R+ +
CP000908_4 156 EVNHRVANSLTLVAALARMQTNAVTDPAA-----KDALEEMQARISA 197

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A iH++LY+sed++ v++++Yl+ L+e+L ++ ++ ++ ++ l
CP000908_4 198 IAGIHRRLYTSEDVEAVELDAYLTGLVEELQLAMKASGRDHAIR--L 242

CP000908_4465: domain 1 of 1, from 191 to 272: score 106.4, E = 5e-30
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+ HRVKN+L+v+++LL LQar +++e+v + aL +++ RV +
CP000908_4 191 EMSHRVKNSLAVVAGLLALQARGTDNEDV-----KSALADARARVEA 232

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A++H++L++ dl ++d++ +le L+e L +++g + +
CP000908_4 233 VAQVHDQLWRQPDLTRIDVAGFLEALCEKLTETAGAHAL-------V 272

CP000908_3978: domain 1 of 1, from 172 to 258: score 90.6, E = 1.7e-25
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+ HRVKNNLQvISSL L ar++ + ++ ++aL+ +R+ +
CP000908_3 172 EVDHRVKNNLQVISSLMLLKARRTPEGDA-----RNALQAMADRIGA 213

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
++ H++LY +d+ + df+e+ L+++L g+++d+ +++ ++
CP000908_3 214 LSTAHRMLYSEGDVTRFDFREFTADLIADLAA--GLDGDRTRIETEI 258

CP000908_1864: domain 1 of 1, from 191 to 278: score 72.3, E = 2.5e-20
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E++HR KN+L + +LL+LQ r+ d++v ++++ E+q R +
CP000908_1 191 EVNHRAKNSLSIAGALLSLQGRRQADPAV-----KALFAETQERLNA 232

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mA H+ L++s+ + +v+ + Y+ L++ L + ++d+i+L++ +
CP000908_1 233 MARAHDLLSRSDHVQQVNAGGYVADLCAALEA-LTESDDRIQLEAQV 278

CP000908_0429: domain 1 of 1, from 157 to 240: score 69.7, E = 1.4e-19
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EI HRV+NNLQv+ SL+ L r + + + + + +RV++
CP000908_0 157 EIYHRVRNNLQVMVSLIGLYGRAAPEA-C-----RGSFDALGQRVRA 197

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+Al++++L++ + ++d+++Yl +L++ L q+ + g++g+ +
CP000908_0 198 IALVQQHLHEAPHIASIDLRDYLHRLASGLGQLRRAGRIGVT----V 240

CP000908_4122: domain 1 of 1, from 142 to 224: score 68.6, E = 3e-19
*->EIHHRVKNNLQvISSLLrLQarkfkd..eevikdEVleaLrEsqnRV
E +HRV NN+Q +++LL LQ rk+ d+++e+ +++ E+q R
CP000908_4 142 ELQHRVANNMQFVAALLALQKRKVIDnpQEA-----ADVFDEAQARL 183

lSmAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<
+++A iH++LY + +++Yl++L+++L+++ g +++ +
CP000908_4 184 QTIARIHRRLYDPAR-ADQPVGQYLQELCSDLLDATGARNI-------V 224

-*

CP000908_4 - -

CP000908_3238: domain 1 of 1, from 163 to 211: score 40.9, E = 2.2e-11
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EI HR +N LQ+IS++L LQ+ ++ d++v ++aL E+++R+ +
CP000908_3 163 EIGHRARNDLQMISAMLTLQSGNSADPAV-----RAALGEAIGRIDA 204

mAliHEe<-*
++++++
CP000908_3 205 LSTLYRQ 211


Histogram of all scores:
score obs exp (one = represents 25 sequences)
----- --- ---
-15 16 0|=
-14 36 0|==
-13 126 30|=*====
-12 331 317|============*=
-11 1458 883|===================================*=======================
-10 1027 1142|========================================== *
-9 723 965|============================= *
-8 486 647|==================== *
-7 254 384|=========== *
-6 181 214|========*
-5 62 115|=== *
-4 48 61|==*
-3 32 32|=*
-2 12 16|*
-1 10 8|*
0 8 4|*
1 0 2|*
2 2 1|*
3 2 0|=
4 1 0|=
> 5 14 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 869.5339
P(chi-square) = 0

Total sequences searched: 4829

Whole sequence top hits:
tophits_s report:
Total hits: 8
Satisfying E cutoff: 8
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 8
Satisfying E cutoff: 8
Total memory: 24K


Acknowledgements:

This research is funded by:

Developed by: