Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

1 accessions found for Methylobacterium extorquens PA1  

Data for CP000908  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP000908.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000908_1851 CDS_2100534-2103152 133.9 2.2e-45 1
CP000908_1163 CDS_1313678-1310553 131.7 1.3e-44 1
CP000908_0851 CDS_953637-952171 129.4 7.6e-44 1
CP000908_3258 CDS_3660206-3658455 124.2 4.5e-42 1
CP000908_1858 CDS_2108114-2109094 116.2 2.4e-39 1
CP000908_3839 CDS_4334251-4331459 110.8 1.7e-37 1
CP000908_1991 CDS_2254176-2256329 110.3 2.4e-37 1
CP000908_1092 CDS_1220213-1218711 105.2 1.4e-35 1
CP000908_2069 CDS_2359837-2361804 97.6 5.2e-33 1
CP000908_0107 CDS_113859-115721 96.0 1.9e-32 1
CP000908_0891 CDS_989554-992952 85.2 8.6e-29 2
CP000908_0775 CDS_855040-856914 85.1 9.4e-29 1
CP000908_4481 CDS_5073567-5076857 65.1 6.2e-22 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000908_1851 1/1 673 755 .. 1 85 [] 133.9 2.2e-45
CP000908_1163 1/1 842 924 .. 1 85 [] 131.7 1.3e-44
CP000908_0851 1/1 297 379 .. 1 85 [] 129.4 7.6e-44
CP000908_3258 1/1 385 472 .. 1 85 [] 124.2 4.5e-42
CP000908_1858 1/1 137 217 .. 1 85 [] 116.2 2.4e-39
CP000908_3839 1/1 727 809 .. 1 85 [] 110.8 1.7e-37
CP000908_1991 1/1 504 590 .. 1 85 [] 110.3 2.4e-37
CP000908_1092 1/1 302 385 .. 1 85 [] 105.2 1.4e-35
CP000908_2069 1/1 454 537 .. 1 85 [] 97.6 5.2e-33
CP000908_0107 1/1 421 504 .. 1 85 [] 96.0 1.9e-32
CP000908_0775 1/1 433 516 .. 1 85 [] 85.1 9.4e-29
CP000908_0891 2/2 925 1008 .. 1 85 [] 83.3 3.9e-28
CP000908_4481 1/1 753 834 .. 1 85 [] 65.1 6.2e-22

Alignments of top-scoring domains:
CP000908_1851: domain 1 of 1, from 673 to 755: score 133.9, E = 2.2e-45
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKNtLA+VQ+ia QTlR+a++l++++eaF++RL +L+raHd+
CP000908_1 673 ELQHRVKNTLAMVQAIASQTLRGATDLNDAREAFAARLISLGRAHDI 719

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Lt+++W A + ++++ +L+ +++ +a+Ri++sGPd
CP000908_1 720 --LTQASWTAAPILQVVQGALSVHAQVGAGRIRISGPD 755

CP000908_1163: domain 1 of 1, from 842 to 924: score 131.7, E = 1.3e-44
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKNtL++VQ+ia QTlRna++ld+++eaF++RL +L+raHd+
CP000908_1 842 ELQHRVKNTLTLVQAIASQTLRNAPDLDAAREAFAARLISLGRAHDI 888

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Ltrs+W A ++e++e +La ++g++ Ri+ sGP+
CP000908_1 889 --LTRSSWTEAPIAEVVEGALAVHRGAAMARIRASGPS 924

CP000908_0851: domain 1 of 1, from 297 to 379: score 129.4, E = 7.6e-44
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E+ HRVKNt+A+VQSia+QTlRnaasld++++++++RL +L++aHd+
CP000908_0 297 EMKHRVKNTIATVQSIAHQTLRNAASLDDARRTLDARLNSLAAAHDI 343

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Lt + ag++L+e +e++L+P++ + Ri++ GP+
CP000908_0 344 --LTTEATAGVTLAEAVESALQPFRVSPRNRIRFGGPE 379

CP000908_3258: domain 1 of 1, from 385 to 472: score 124.2, E = 4.5e-42
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKNtLA+VQ+i+ T+R+a+s+d+f+eaF gR+ +L+ +H++
CP000908_3 385 ELHHRVKNTLATVQAIVGSTARTATSIDSFHEAFVGRIKSLAHTHSV 431

VpLtrseWagAdLreLleaeLaPygged.....aeRitlsGPd<-*
Lt++ W+ A+Lr+Ll++eL Py+ ++++++ Ri+l+GP+
CP000908_3 432 --LTEATWQTASLRDLLASELMPYAESEtetspDLRIVLDGPA 472

CP000908_1858: domain 1 of 1, from 137 to 217: score 116.2, E = 2.4e-39
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKNtLA+VQ++ + T+R++ s++ef +a+sgR+++L+r+H L
CP000908_1 137 ELHHRVKNTLATVQAVLNATVRSSLSIPEFTRALSGRIASLARTHAL 183

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
+t++ ++ A++ Ll+aeL+Py+ +eR+tl+GP+
CP000908_1 184 --ITEDLAQAASFDGLLRAELDPYDE--RERLTLEGPA 217

CP000908_3839: domain 1 of 1, from 727 to 809: score 110.8, E = 1.7e-37
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR KNtL++ Q+ia QTlRna+++++ +ea+ +RL+AL+ aHd+
CP000908_3 727 ELSHRLKNTLTMAQAIASQTLRNATDIASVKEALVARLVALGKAHDI 773

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L e++gA L ++++ +L +++ ++Ri+lsGP+
CP000908_3 774 --LLSGEGEGAALQAVIAGALTIHDDGEPGRIHLSGPA 809

CP000908_1991: domain 1 of 1, from 504 to 590: score 110.3, E = 2.4e-37
*->ELnHRVKNtLAvVQSiarQTlRn..aasldefveaFsgRLqALsraH
ELnHRVKNtLA+VQSia Q+lR+ + ++ ++++aF++RL AL+raH
CP000908_1 504 ELNHRVKNTLATVQSIAMQSLRGldGEEALAARAAFEARLLALARAH 550

dLVpLtrseWagAdLreLleaeLaPygged..aeRitlsGPd<-*
d+ Ltr++W+gA+L+ ++ +++P ++ d+++ R+++sGP+
CP000908_1 551 DV--LTRESWEGAELKTVVGDAIRPLEAGDgqESRFVVSGPR 590

CP000908_1092: domain 1 of 1, from 302 to 385: score 105.2, E = 1.4e-35
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR +N+LAvV Sia+QT +++s ++f ++F +RL+ALsr+++L
CP000908_1 302 ELQHRTRNLLAVVRSIAQQTMTQTGSTEQFCDRFNDRLAALSRVQGL 348

VpLtrseWagAdLreLleaeLaPygged.aeRitlsGPd<-*
L+rs+ ++ ++ +L+++eL+++g ++ + R+ l GP+
CP000908_1 349 --LSRSDKEPITIQALIQIELDAFGVAAmQARVALKGPP 385

CP000908_2069: domain 1 of 1, from 454 to 537: score 97.6, E = 5.2e-33
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR +N+L vV Sia+QT +++ + f+e+F +RL+ALsr+++L
CP000908_2 454 ELQHRTRNLLGVVRSIAHQTMAQTGPTERFREQFNDRLAALSRVQGL 500

VpLtrseWagAdLreLleaeLaPygge.daeRitlsGPd<-*
L+rse ++ +Lr L++ eL++ gg + a+Ri++ GP+
CP000908_2 501 --LSRSEQEPITLRTLIRTELDALGGGdFADRIHIAGPP 537

CP000908_0107: domain 1 of 1, from 421 to 504: score 96.0, E = 1.9e-32
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR +N+L+vV +ia+QT +++ f+e+F +RL+ALsr+++L
CP000908_0 421 ELQHRTRNLLTVVRAIAQQTMAQTGPTVLFREQFNDRLAALSRVQGL 467

VpLtrseWagAdLreLleaeLaPygged.aeRitlsGPd<-*
L+rs+ ++ ++r+L+e+eL++ g+ d +eRi ++GP+
CP000908_0 468 --LSRSDQEPITIRALVEMELDALGATDmGERIAVEGPR 504

CP000908_0775: domain 1 of 1, from 433 to 516: score 85.1, E = 9.4e-29
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR +N+++vV ia+QTl +++ + f++ F +RL+ALsr+++L
CP000908_0 433 ELQHRTRNLITVVRLIAQQTLAQTGPTERFRTCFNDRLAALSRVQGL 479

VpLtrseWagAdLreLleaeLaPygge.daeRitlsGPd<-*
L+rs+ ++ ++r+L++aeL++ g ++ + R++l+GP+
CP000908_0 480 --LSRSDQQPITIRALIRAELDALGFAgVQARVVLEGPP 516

CP000908_0891: domain 2 of 2, from 925 to 1008: score 83.3, E = 3.9e-28
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR +N+++vV S+a QT +++s++ f+++F +RL+ Lsr+++L
CP000908_0 925 ELQHRTRNLITVVRSLAEQTMARSDSMPMFRARFYDRLAVLSRVQGL 971

VpLtrseWagAdLreLleaeLaPygge.daeRitlsGPd<-*
L+rs ++ +L++L++ eL++ g+ ++++Ri l+GP+
CP000908_0 972 --LSRSTIEPITLHALIATELDALGAWeASDRIYLDGPS 1008

CP000908_4481: domain 1 of 1, from 753 to 834: score 65.1, E = 6.2e-22
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRV+N++Av Si++ T +a+++ +++ + gRL L+r++ L
CP000908_4 753 ELQHRVRNIMAVTRSIVARTGERAETVSDYASLVGGRLLTLARVQAL 799

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Ltrs ag+ + +++ e+++ + a++ lsGP
CP000908_4 800 --LTRSPNAGVPVATIVRDEIDAQDLR-ADQYDLSGPK 834


Histogram of all scores:
score obs exp (one = represents 15 sequences)
----- --- ---
-14 15 0|=
-13 54 0|====
-12 329 0|======================
-11 387 39|==*=======================
-10 647 499|=================================*==========
-9 846 1235|========================================================= *
-8 878 1283|==========================================================*
-7 620 861|========================================== *
-6 406 470|============================ *
-5 280 233|===============*===
-4 138 110|=======*==
-3 85 51|===*==
-2 54 23|=*==
-1 34 10|*==
0 12 4|*
1 9 2|*
2 8 1|*
3 3 0|=
4 3 0|=
5 1 0|=
6 0 0|
> 7 20 -|==


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 3559.1970
P(chi-square) = 0

Total sequences searched: 4829

Whole sequence top hits:
tophits_s report:
Total hits: 13
Satisfying E cutoff: 13
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 13
Satisfying E cutoff: 13
Total memory: 26K


Acknowledgements:

This research is funded by:

Developed by: