Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

1 accessions found for Renibacterium salmoninarum ATCC 33209  

Data for CP000910  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000910.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000910_2875 CDS_2595242-2594022 84.3 1.3e-24 1
CP000910_0837 CDS_723927-725132 79.5 3.3e-23 1
CP000910_0284 CDS_244381-243035 64.2 1.1e-18 1
CP000910_0374 CDS_315827-317047 61.3 7.9e-18 1
CP000910_3418 CDS_3080275-3081447 59.1 3.3e-17 1
CP000910_3349 CDS_3016841-3015873 46.7 1.5e-13 1
CP000910_2702 CDS_2451234-2450080 43.1 1.8e-12 1
CP000910_1035 CDS_894573-894364 37.0 1.2e-10 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000910_2875 1/1 217 285 .. 1 70 [] 84.3 1.3e-24
CP000910_0837 1/1 188 256 .. 1 70 [] 79.5 3.3e-23
CP000910_0284 1/1 250 315 .. 1 70 [] 64.2 1.1e-18
CP000910_0374 1/1 214 281 .. 1 70 [] 61.3 7.9e-18
CP000910_3418 1/1 190 260 .. 1 70 [] 59.1 3.3e-17
CP000910_3349 1/1 194 242 .. 1 45 [. 46.7 1.5e-13
CP000910_2702 1/1 193 258 .. 3 70 .] 43.1 1.8e-12
CP000910_1035 1/1 42 69 .] 1 28 [. 37.0 1.2e-10

Alignments of top-scoring domains:
CP000910_2875: domain 1 of 1, from 217 to 285: score 84.3, E = 1.3e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R AR++HD +g+sL++i++++ela rll d++pe+a+++++ +
CP000910_2 217 ERSRVARDMHDILGHSLTVIAVKAELAGRLL--DAAPERAAAEIHDV 261

relarealaevRrllgdLR.paal<-*
++lar al +vR++++++R+ +l
CP000910_2 262 EQLARGALVDVRATVRGYRgVNVL 285

CP000910_0837: domain 1 of 1, from 188 to 256: score 79.5, E = 3.3e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERa IARELHD+v++++s++++q+ +ar++ + +e++ +++dei
CP000910_0 188 ERAGIARELHDVVAHGMSLVTVQATTARYRH--PGLDERIIAEFDEI 232

relarealaevRrllgdLR.paal<-*
++++r+a+ae+R++lg+LR++++
CP000910_0 233 AGHSRRAMAEMRQMLGVLRsEGTG 256

CP000910_0284: domain 1 of 1, from 250 to 315: score 64.2, E = 1.1e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERa +AR+LHD+++ +Lsai+lq+e+a r ++dpe + l++
CP000910_0 250 ERAKMARDLHDVIAGRLSAIALQSEAAIR----TSDPEVRLTVLRTS 292

relarealaevRrllgdLRpaal<-*
re++ +ala++R+++ +L+ +++
CP000910_0 293 RETSLKALADMRQMIDVLHAGDE 315

CP000910_0374: domain 1 of 1, from 214 to 281: score 61.3, E = 7.9e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R A +LHD g++L +i+l++ela+r++ d+dpe a+++++e+
CP000910_0 214 ERLRYAADLHDIQGHHLQVIALKTELAERVM--DRDPETAKQQIHEA 258

relarealaevRrllgdLRpaal<-*
+ lar+al+++R+l++++R a+
CP000910_0 259 QILARTALEDTRALVRGYRQVAF 281

CP000910_3418: domain 1 of 1, from 190 to 260: score 59.1, E = 3.3e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrllds.dkdpeearealde
ERaRIARE+HD+++QsL ++++qle+a++l +s+ + p e++ ++ +
CP000910_3 190 ERARIAREIHDVLAQSLGGLAIQLEAAEALQESgYRGP-ELAGRISR 235

irelarealaevRrllgdLR.paal<-*
+r+la e+l+++Rr++++LR + ++
CP000910_3 236 ARRLAIEGLDDTRRAVQALRaDVTD 260

CP000910_3349: domain 1 of 1, from 194 to 242: score 46.7, E = 1.5e-13
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe......ear
ERaRIAR++HD+vg+sLs+i+lql++a +l ++ e+++++++a+
CP000910_3 194 ERARIARDIHDVVGHSLSGIALQLDMADALH--QRGREkrsesgRAQ 238

eald<-*
al+
CP000910_3 239 GALA 242

CP000910_2702: domain 1 of 1, from 193 to 258: score 43.1, E = 1.8e-12
*->aRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdeire
+R+ R++HD+ Q+L +++ l a+r+l ++ + a+e ++e+ +
CP000910_2 193 RRLERDIHDGPQQRLVRVSMDLKSAQRRL--TRGEPGAEELVAEALK 237

larealaevRrllgdLRpaal<-*
+++l e+R++ +++ p++l
CP000910_2 238 QTQDTLGELRAISRGIAPPIL 258

CP000910_1035: domain 1 of 1, from 42 to 69: score 37.0, E = 1.2e-10
*->ERaRIARELHDsvgQsLsaiklqlelar<-*
ERa+IARE+HD v++sLs+i+ q+++ r
CP000910_1 42 ERAHIAREMHDIVAHSLSVIITQADGGR 69


Histogram of all scores:
score obs exp (one = represents 12 sequences)
----- --- ---
-15 2 0|=
-14 25 0|===
-13 75 0|=======
-12 142 39|===*========
-11 236 321|==================== *
-10 563 745|=============================================== *
-9 690 846|==========================================================*
-8 513 652|=========================================== *
-7 401 410|==================================*
-6 283 232|===================*====
-5 241 124|==========*==========
-4 134 65|=====*======
-3 80 33|==*====
-2 60 17|=*===
-1 25 8|*==
0 11 4|*
1 7 2|*
2 3 1|*
3 1 0|=
4 2 0|=
> 5 13 -|==


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 792.7939
P(chi-square) = 0

Total sequences searched: 3507

Whole sequence top hits:
tophits_s report:
Total hits: 8
Satisfying E cutoff: 8
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 8
Satisfying E cutoff: 8
Total memory: 23K


Acknowledgements:

This research is funded by:

Developed by: