Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
264 projects found  

1 accessions found for Pseudomonas putida GB-1  

Data for CP000926  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP000926.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000926_2569 CDS_2906816-2904273 115.7 4.1e-39 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000926_2569 1/1 520 600 .. 1 85 [] 115.7 4.1e-39

Alignments of top-scoring domains:
CP000926_2569: domain 1 of 1, from 520 to 600: score 115.7, E = 4.1e-39
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKN+L+++ +++++ +++l+++v+++ gR+qALs aHd+
CP000926_2 520 ELNHRVKNILSLIGALVAHPTSESQTLQDYVATLKGRIQALSLAHDQ 566

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
++r + +g++L++LleaeL+Py+++ a+ i+l+GP+
CP000926_2 567 --VVRGD-GGGRLAKLLEAELSPYRTA-AGVIELQGPN 600


Histogram of all scores:
score obs exp (one = represents 18 sequences)
----- --- ---
-15 2 0|=
-14 13 0|=
-13 61 0|====
-12 400 0|=======================
-11 566 44|==*=============================
-10 857 559|===============================*================
-9 957 1384|====================================================== *
-8 1026 1437|========================================================= *
-7 590 965|================================= *
-6 368 526|===================== *
-5 245 261|==============*
-4 135 123|======*=
-3 93 57|===*==
-2 47 26|=*=
-1 26 12|*=
0 13 5|*
1 4 2|*
2 2 1|*
3 0 0|
> 4 4 -|=


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 6827.4502
P(chi-square) = 0

Total sequences searched: 5409

Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: