Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

3 accessions found for Caulobacter sp. K31  

Data for CP000927  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP000927.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000927_0092 CDS_103195-104907 130.2 9.5e-37 1
CP000927_4537 CDS_4934636-4935745 123.0 1e-34 1
CP000927_1468 CDS_1570281-1569208 113.6 4.8e-32 1
CP000927_3751 CDS_4079383-4080444 89.9 2.8e-25 1
CP000927_4313 CDS_4706156-4704519 76.8 1.4e-21 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000927_0092 1/1 369 455 .. 1 94 [] 130.2 9.5e-37
CP000927_4537 1/1 177 265 .. 1 94 [] 123.0 1e-34
CP000927_1468 1/1 156 242 .. 1 94 [] 113.6 4.8e-32
CP000927_3751 1/1 152 239 .. 1 94 [] 89.9 2.8e-25
CP000927_4313 1/1 350 434 .. 1 94 [] 76.8 1.4e-21

Alignments of top-scoring domains:
CP000927_0092: domain 1 of 1, from 369 to 455: score 130.2, E = 9.5e-37
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQ+ISSLL++Q r +d+++ + aL+++++R+ +
CP000927_0 369 EIHHRVKNNLQIISSLLNMQQRALTDPAA-----RTALNDTRQRITA 410

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
A+i++ LY++ dl++vd++++le+Lt+ L+ g++ i+ + +
CP000927_0 411 LAQIYRALYQGPDLKRVDLRPFLEELTALLLAGDISGNGAIRTE--V 455

CP000927_4537: domain 1 of 1, from 177 to 265: score 123.0, E = 1e-34
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+ HRVKNNLQ+ISSLL LQ r+++d++v ++ Lr RV +
CP000927_4 177 EVDHRVKNNLQLISSLLLLQNRRVTDPAV-----KASLRGMLERVSA 218

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A++H++L +s+d+++ d+s++++ L+++++ +++++++++L+l+
CP000927_4 219 IATVHRRLFQSDDVERFDVSAFVRDLVSDMMGGARRDDIKVRLDLER 265

CP000927_1468: domain 1 of 1, from 156 to 242: score 113.6, E = 4.8e-32
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E++HRV N+LQ+I+S+L+L ar +++ee+ + +L+++++RV+S
CP000927_1 156 EMQHRVANSLQIIASILMLKARAVTSEET-----RFHLKDAHQRVIS 197

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A ++ +L+ s+++d++++++YlekL+++L s+ ++s+ i Lk +
CP000927_1 198 VAEVQSHLHASGGVDQIEVGPYLEKLCGSLAASMIGDSQPIVLK--V 242

CP000927_3751: domain 1 of 1, from 152 to 239: score 89.9, E = 2.8e-25
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHRV N+LQ+I+S + ark+++ e+ + L++++nRV+S
CP000927_3 152 EVHHRVANSLQIIASVILQSARKVQSDET-----RLYLHDAHNRVMS 193

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A ++++L s+ + v ++ Y++ L+ ++ s+ ++ ++isL +D+
CP000927_3 194 IAALQQQLAVSRR-GAVALRGYFTQLCQSIGASMIHDQEKISLGVDV 239

CP000927_4313: domain 1 of 1, from 350 to 434: score 76.8, E = 1.4e-21
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+ HRVKNNLQ++ SLL +Qark +d+e+ + aL ++R+ +
CP000927_4 350 EVYHRVKNNLQIVDSLLVMQARKLSDPEA-----KQALLGLRGRIYA 391

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
l+H +L s+dl t d+ ++l++L +n+ + gv ++ ++L +
CP000927_4 392 LGLVHGQLMGSKDLRTFDITPFLRELSSNIVD--GVAGNEVQLT--V 434


Histogram of all scores:
score obs exp (one = represents 25 sequences)
----- --- ---
-15 11 0|=
-14 36 0|==
-13 95 31|=*==
-12 313 332|=============*
-11 1474 925|====================================*======================
-10 1073 1197|=========================================== *
-9 808 1011|================================= *
-8 561 678|======================= *
-7 249 403|========== *
-6 239 224|========*=
-5 81 120|====*
-4 52 64|==*
-3 25 33|=*
-2 12 17|*
-1 8 9|*
0 5 4|*
1 2 2|*
> 2 17 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 606.3495
P(chi-square) = 0

Total sequences searched: 5061

Whole sequence top hits:
tophits_s report:
Total hits: 5
Satisfying E cutoff: 5
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 5
Satisfying E cutoff: 5
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: