Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

3 accessions found for Caulobacter sp. K31  

Data for CP000927  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP000927.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000927_1691 CDS_1788642-1789661 141.9 4.3e-48 1
CP000927_4095 CDS_4466173-4467327 138.4 7e-47 1
CP000927_0925 CDS_982874-980595 130.5 3.4e-44 1
CP000927_1066 CDS_1133576-1132131 126.8 6.4e-43 1
CP000927_1233 CDS_1304833-1302938 126.5 8e-43 1
CP000927_3965 CDS_4308206-4309939 118.1 5.6e-40 1
CP000927_0079 CDS_96032-94113 117.8 6.9e-40 1
CP000927_0467 CDS_512206-511157 101.8 2.1e-34 1
CP000927_2757 CDS_3006612-3007613 96.0 1.9e-32 1
CP000927_3286 CDS_3570611-3569529 79.9 5.9e-27 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000927_1691 1/1 144 225 .. 1 85 [] 141.9 4.3e-48
CP000927_4095 1/1 187 269 .. 1 85 [] 138.4 7e-47
CP000927_0925 1/1 568 653 .. 1 85 [] 130.5 3.4e-44
CP000927_1066 1/1 279 366 .. 1 85 [] 126.8 6.4e-43
CP000927_1233 1/1 307 387 .. 1 85 [] 126.5 8e-43
CP000927_3965 1/1 378 455 .. 1 85 [] 118.1 5.6e-40
CP000927_0079 1/1 309 388 .. 1 85 [] 117.8 6.9e-40
CP000927_0467 1/1 156 239 .. 1 85 [] 101.8 2.1e-34
CP000927_2757 1/1 140 227 .. 1 85 [] 96.0 1.9e-32
CP000927_3286 1/1 162 239 .. 1 85 [] 79.9 5.9e-27

Alignments of top-scoring domains:
CP000927_1691: domain 1 of 1, from 144 to 225: score 141.9, E = 4.3e-48
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKNtLA+VQSia Q+lRna+ + ++aF+gRL+A +++H++
CP000927_1 144 ELNHRVKNTLATVQSIASQSLRNAGVDPVVRRAFEGRLMAIAATHNV 190

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Lt+++W+ A+Lr+++ ++ Py+++ ++++t++G+d
CP000927_1 191 --LTDENWSAASLRQIIDGAVTPYRAH-PGQLTITGED 225

CP000927_4095: domain 1 of 1, from 187 to 269: score 138.4, E = 7e-47
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKNtLA VQSiarQTlR+a+s+++f+e+F+ RL+ Lsr+H L
CP000927_4 187 ELDHRVKNTLASVQSIARQTLRTAPSPAAFAESFESRLMGLSRVHEL 233

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Lt + W+ dL+++le +L+P+gg +++ +t+ GP+
CP000927_4 234 --LTGRAWGRTDLHDVLETALQPFGGLADPHFTVRGPA 269

CP000927_0925: domain 1 of 1, from 568 to 653: score 130.5, E = 3.4e-44
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKN+LA++Q+ia+QT++ a+sl+++ eaFs+R++AL++aHdL
CP000927_0 568 ELNHRVKNSLATIQAIAAQTFHAARSLPQAQEAFSARIVALAEAHDL 614

VpLtrseWagAdLreLleaeLaPygged...aeRitlsGPd<-*
Ltr++W+gAdL +Ll++ +gg+ +++ +R+ +sGP+
CP000927_0 615 --LTRENWEGADLTDLLTRLEILHGGPPqgeIRRFMFSGPS 653

CP000927_1066: domain 1 of 1, from 279 to 366: score 126.8, E = 6.4e-43
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKNtL+++QS+a QTlRn +++ ++ ++F++RL Lsr+HdL
CP000927_1 279 ELNHRVKNTLSTIQSMASQTLRNDPDPLSAYGKFEARLLGLSRVHDL 325

VpLtrseWagAdLreLleaeLaPygged.....aeRitlsGPd<-*
Lt +W gAdLr++++++L+P+ ++ ++ ++ ++++GPd
CP000927_1 326 --LTGQHWHGADLRAVATRALRPFVEDAaggaaGGGVEIDGPD 366

CP000927_1233: domain 1 of 1, from 307 to 387: score 126.5, E = 8e-43
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E +HR KN LAvVQS+a T + +++++v+a+sgR+ +L+r+H+L
CP000927_1 307 EIDHRAKNVLAVVQSLASLT--PFVDKEQYVAALSGRIGSLARSHSL 351

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L+ ++W+gA+L Ll++eL+Pyg+e + R+t+ GP+
CP000927_1 352 --LSGARWSGARLDVLLQQELEPYGAENDNRVTIAGPP 387

CP000927_3965: domain 1 of 1, from 378 to 455: score 118.1, E = 5.6e-40
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKNtL +VQS+arQ+l + a+ + ++aF RL+AL+raHdL
CP000927_3 378 ELNHRVKNTLFTVQSLARQSLGRPADTPG-LTAFNERLMALARAHDL 423

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Ltrs W+gA+Lre+le++L+Py +R +l GP
CP000927_3 424 --LTRSVWEGAELREILEETLEPY----LDRTVLAGPL 455

CP000927_0079: domain 1 of 1, from 309 to 388: score 117.8, E = 6.9e-40
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR+KN+LA V S+a Q++R a sld f+ aF+gRL ++s+aHdL
CP000927_0 309 ELDHRIKNILAAVLSVAGQSARKASSLDGFLKAFTGRLKSMSSAHDL 355

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L+ ++W+gA+L+ +++aeL+ + + + +++GP+
CP000927_0 356 --LSAARWRGATLARIAAAELGGLA---PNQTRWDGPE 388

CP000927_0467: domain 1 of 1, from 156 to 239: score 101.8, E = 2.1e-34
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHR NtL+ V +ia+QTlR+ a+++ veaF+gR AL+ aH L
CP000927_0 156 ELNHRTQNTLTSVLAIAAQTLRGKADKAL-VEAFEGRVLALAKAHTL 201

VpLtrseWagAdLreLleaeLaPygge.d.aeRitlsGPd<-*
L r++W+ ++Lr++le+ L+P++ e+d+ R+tl+G +
CP000927_0 202 --LGRDNWEAVSLRDVLERILGPFDLEnDgLSRFTLEGGE 239

CP000927_2757: domain 1 of 1, from 140 to 227: score 96.0, E = 1.9e-32
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E++HRVKN+L++ +++ + T+R++++ ++++ +++RL +L+raHdL
CP000927_2 140 EMSHRVKNLLTIASALTAITSRSTETTTDMARELTDRLTSLGRAHDL 186

V.p.LtrseWagAdLreLleaeLaPygged..aeRitlsGPd<-*
V+p ++ A L++L++ LaPy++ d ++Ri++s P+
CP000927_2 187 VrPiPGQDG-KAALLGDLISVLLAPYDDLDafSGRIRVSVPR 227

CP000927_3286: domain 1 of 1, from 162 to 239: score 79.9, E = 5.9e-27
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E++HR N LA+V +i+r + a+++ ++++a+ R qAL++aH L
CP000927_3 162 EVDHRAMNALAIVEGIVRLS--CADDPSQYAAAIQRRVQALASAHAL 206

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L r W+ + L eLl+ +++ y+ ++Ri ++GP+
CP000927_3 207 --LGRQAWRDVQLEELLRTQVEGYA---GRRIAFEGPP 239


Histogram of all scores:
score obs exp (one = represents 17 sequences)
----- --- ---
-15 4 0|=
-14 10 0|=
-13 61 0|====
-12 341 0|=====================
-11 463 41|==*=========================
-10 680 523|==============================*=========
-9 927 1295|======================================================= *
-8 955 1344|========================================================= *
-7 651 903|======================================= *
-6 395 493|======================== *
-5 263 244|==============*=
-4 118 115|======*
-3 78 53|===*=
-2 43 24|=*=
-1 28 11|*=
0 8 5|*
1 15 2|*
2 2 1|*
3 1 0|=
4 1 0|=
> 5 17 -|=


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 4704.9399
P(chi-square) = 0

Total sequences searched: 5061

Whole sequence top hits:
tophits_s report:
Total hits: 10
Satisfying E cutoff: 10
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 10
Satisfying E cutoff: 10
Total memory: 24K


Acknowledgements:

This research is funded by:

Developed by: