Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

3 accessions found for Methylobacterium sp. 4-46  

Data for CP000943  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP000943.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000943_3010 CDS_3536118-3533524 116.5 9.3e-33 1
CP000943_0281 CDS_368689-367640 99.9 5e-28 1
CP000943_2151 CDS_2537175-2535997 88.2 1e-24 1
CP000943_4592 CDS_5331328-5330180 73.6 1.5e-20 1
CP000943_4195 CDS_4896010-4897038 63.8 9.3e-18 1
CP000943_6201 CDS_7181295-7182401 59.7 1.4e-16 1
CP000943_2603 CDS_3063322-3064299 47.0 5.6e-13 2

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000943_3010 1/1 674 759 .. 1 94 [] 116.5 9.3e-33
CP000943_0281 1/1 157 243 .. 1 94 [] 99.9 5e-28
CP000943_2151 1/1 203 285 .. 1 94 [] 88.2 1e-24
CP000943_4592 1/1 162 249 .. 1 94 [] 73.6 1.5e-20
CP000943_4195 1/1 152 235 .. 1 94 [] 63.8 9.3e-18
CP000943_6201 1/1 178 264 .. 1 94 [] 59.7 1.4e-16
CP000943_2603 1/2 133 186 .. 1 56 [. 46.0 1.1e-12

Alignments of top-scoring domains:
CP000943_3010: domain 1 of 1, from 674 to 759: score 116.5, E = 9.3e-33
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EI HRVKN+LQ++S+ L +Q r++kd+++ + a+ E+ +RV+S
CP000943_3 674 EIDHRVKNSLQIVSAFLHMQRRQVKDPAA-----QQAFSETMGRVMS 715

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A +H+ LY++e++d vd+++ +e+L+++L +g+ ++ L+lD
CP000943_3 716 VARVHDSLYQTESVDEVDLGQTIENLCADLSAMAGD---RHTLELDA 759

CP000943_0281: domain 1 of 1, from 157 to 243: score 99.9, E = 5e-28
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E++HRV N+L+++++L r+Q+ ++d+++ + aL+E q R+ +
CP000943_0 157 EVNHRVANSLALVAALARMQTNAVTDPAA-----KSALEEMQARISA 198

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A iH++LY+s d+ v++++Yl L+e+L s+ + ++ ++ l
CP000943_0 199 IAGIHRRLYTSQDVQAVEVDAYLASLVEELEASMKAAGRDHAIR--L 243

CP000943_2151: domain 1 of 1, from 203 to 285: score 88.2, E = 1e-24
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+ HRVKN+L v+++LLrLQar + + ev + aL+++ R+++
CP000943_2 203 EMSHRVKNSLGVVAGLLRLQARDTHSDEV-----RFALEDAGARIAT 244

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A++H++L+++ ++tv+++ ++++L++ L +++ + + +
CP000943_2 245 VAQVHDHLWRGLHVGTVEVAGFVRELVGKLQEAAPHHPLH------C 285

CP000943_4592: domain 1 of 1, from 162 to 249: score 73.6, E = 1.5e-20
*->EIHHRVKNNLQvISSLLrLQarkfkd..eevikdEVleaLrEsqnRV
E +HRV NN+Q ++SLL LQ r++ ++++ + l aL E++ R
CP000943_4 162 ELQHRVANNMQFVASLLALQRRQAAGdpQRA-----LLALDEARTRL 203

lSmAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<
++A iH++LY ++ld+ ++eYl++++++L+ ++g g + +++ +
CP000943_4 204 ETIARIHRRLYDPDSLDR-PVGEYLQEICSDLIATAGAGEIVCRVE--I 249

-*

CP000943_4 - -

CP000943_4195: domain 1 of 1, from 152 to 235: score 63.8, E = 9.3e-18
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+ HRV+NNLQv+ SL+ L r + + + + a+ +RV++
CP000943_4 152 EVYHRVRNNLQVMVSLIGLYGRAAPQP-C-----RPAFDALGQRVRA 192

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+Al++++L++ + ++d++eYl++L + L q+ + g++ ++ +
CP000943_4 193 IALVQQHLHEAPAIASIDLAEYLQRLGRGLAQLRRAGRIVVE----V 235

CP000943_6201: domain 1 of 1, from 178 to 264: score 59.7, E = 1.4e-16
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E HR KN LQv++SL+ L ar++ d + +++L R+ +
CP000943_6 178 ELDHRAKNTLQVVASLVLLRARRAPDAAS-----RAVLDRMAERIGA 219

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
A ++++L ++ ++d+++ e+L+++ gv++d++ + +++
CP000943_6 220 LAAVQRHLAGRDEDRRLDLGALAEELAGEVAA--GVERDRVTVAAEV 264

CP000943_2603: domain 1 of 2, from 133 to 186: score 46.0, E = 1.1e-12
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikd.EVleaLrEsqnRVl
E +HRV NNL +I+SLLrL+ r+ ++ e ++ EV L+ +q+R +
CP000943_2 133 ELQHRVANNLSLIASLLRLEQRRLQEGEPCDPvEV---LERAQGRLA 176

SmAliHEeLY<-*
mA iH++L+
CP000943_2 177 LMARIHRRLH 186


Histogram of all scores:
score obs exp (one = represents 34 sequences)
----- --- ---
-15 26 0|=
-14 58 0|==
-13 175 41|=*====
-12 490 434|============*==
-11 1967 1208|===================================*======================
-10 1411 1564|========================================== *
-9 949 1321|============================ *
-8 688 886|===================== *
-7 345 526|=========== *
-6 240 293|========*
-5 101 157|=== *
-4 57 83|==*
-3 49 43|=*
-2 13 22|*
-1 12 11|*
0 5 6|*
1 0 3|*
2 4 1|*
3 0 0|
> 4 19 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 1184.8629
P(chi-square) = 0

Total sequences searched: 6609

Whole sequence top hits:
tophits_s report:
Total hits: 7
Satisfying E cutoff: 7
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 7
Satisfying E cutoff: 7
Total memory: 23K


Acknowledgements:

This research is funded by:

Developed by: