Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

3 accessions found for   

Data for CP000943  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP000943.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000943_2414 CDS_2844908-2846137 134.6 1.7e-45 1
CP000943_5615 CDS_6512616-6513656 130.7 3.8e-44 1
CP000943_5299 CDS_6123549-6125309 130.3 5.1e-44 1
CP000943_3976 CDS_4654249-4652501 126.5 1e-42 1
CP000943_1011 CDS_1188911-1187748 125.6 2.1e-42 1
CP000943_5026 CDS_5805228-5807216 123.9 7.7e-42 1
CP000943_6551 CDS_7589558-7590955 122.9 1.7e-41 1
CP000943_1582 CDS_1872481-1875003 118.7 4.5e-40 1
CP000943_0793 CDS_941808-940270 103.7 6.1e-35 1
CP000943_5312 CDS_6143055-6144224 99.4 1.8e-33 1
CP000943_5301 CDS_6127074-6125902 91.7 7e-31 1
CP000943_3419 CDS_4045992-4048370 86.3 5e-29 1
CP000943_5890 CDS_6827506-6830691 82.5 9.8e-28 2

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000943_2414 1/1 216 296 .. 1 85 [] 134.6 1.7e-45
CP000943_5615 1/1 151 233 .. 1 85 [] 130.7 3.8e-44
CP000943_5299 1/1 394 474 .. 1 85 [] 130.3 5.1e-44
CP000943_3976 1/1 384 466 .. 1 85 [] 126.5 1e-42
CP000943_1011 1/1 188 268 .. 1 85 [] 125.6 2.1e-42
CP000943_5026 1/1 458 545 .. 1 85 [] 123.9 7.7e-42
CP000943_6551 1/1 268 350 .. 1 85 [] 122.9 1.7e-41
CP000943_1582 1/1 629 715 .. 1 85 [] 118.7 4.5e-40
CP000943_0793 1/1 318 400 .. 1 85 [] 103.7 6.1e-35
CP000943_5312 1/1 195 277 .. 1 85 [] 99.4 1.8e-33
CP000943_5301 1/1 196 278 .. 1 85 [] 91.7 7e-31
CP000943_3419 1/1 456 537 .. 1 85 [] 86.3 5e-29
CP000943_5890 2/2 861 944 .. 1 85 [] 82.2 1.2e-27

Alignments of top-scoring domains:
CP000943_2414: domain 1 of 1, from 216 to 296: score 134.6, E = 1.7e-45
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKNtLA+VQ+ +QTlR+aasl+e++ea+++RL ALs aHd+
CP000943_2 216 ELNHRVKNTLATVQAFTTQTLRSAASLAEAREAITARLIALSKAHDV 262

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Lt+++W+gAdL+++++ +L+ +g+ ++R +++G +
CP000943_2 263 --LTDENWQGADLAQIVADALRLHGD--GQRCRWQGNP 296

CP000943_5615: domain 1 of 1, from 151 to 233: score 130.7, E = 3.8e-44
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKNtLA+VQ++ ++R+a+s+def ++Fs+R +L+ +H+L
CP000943_5 151 ELHHRVKNTLATVQALLGASSRSATSVDEFYQSFSARVISLAKTHNL 197

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Lt++ W++A+L e le eLaPy+++ ++Ri l+GP+
CP000943_5 198 --LTDDYWQMASLQEMLENELAPYNDAEGRRIALDGPP 233

CP000943_5299: domain 1 of 1, from 394 to 474: score 130.3, E = 5.1e-44
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKNtLA+VQ+ia+QT+R +++ + e+F++RL ALs aHdL
CP000943_5 394 ELNHRVKNTLATVQAIAHQTFR--GDSSDRTETFEARLLALSKAHDL 438

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Ltr++W+gA L e+++a++aP++ d++R+++ G +
CP000943_5 439 --LTRESWEGANLTEIVSAAIAPFRRTDGTRFQIVGRQ 474

CP000943_3976: domain 1 of 1, from 384 to 466: score 126.5, E = 1e-42
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKNtLA+VQ+ia+QTlR+ lde++ea++gRL +L+raHd+
CP000943_3 384 ELQHRVKNTLAMVQAIAAQTLRGVSGLDEAREALAGRLISLGRAHDI 430

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Lt+++W A ++e++ea+ ++++++da Ri+ GPd
CP000943_3 431 --LTEAHWKAAPISEIIEAARGAHEAADAVRIRARGPD 466

CP000943_1011: domain 1 of 1, from 188 to 268: score 125.6, E = 2.1e-42
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKNtLA+VQS+a QT+R + +++ aF+gRLqALs aHd+
CP000943_1 188 ELNHRVKNTLAIVQSLALQTFREVEGAGAARSAFEGRLQALSHAHDV 234

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Ltr +W+ AdL+e+++ + ++g ++R+ sGP+
CP000943_1 235 --LTRVHWRAADLGEIVATAATACGV--EGRVSASGPP 268

CP000943_5026: domain 1 of 1, from 458 to 545: score 123.9, E = 7.7e-42
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKNtLA+VQ+i+ T+R+a s+++f eaF gR+++L+ +H++
CP000943_5 458 ELHHRVKNTLATVQAIVGSTARTASSIESFYEAFVGRIMSLAHTHSV 504

VpLtrseWagAdLreLleaeLaPygged.....aeRitlsGPd<-*
Lt++ W+ A+Lr Lle eL Py++ +++ ++R+tl+GP+
CP000943_5 505 --LTEDVWQTASLRGLLENELTPYADGPmtpeaDGRVTLEGPA 545

CP000943_6551: domain 1 of 1, from 268 to 350: score 122.9, E = 1.7e-41
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRV+N+L+vVQ++a+QT+R+a sl++f e+Fs RL AL+++H L
CP000943_6 268 ELDHRVRNILTVVQALAAQTARTASSLPSFTETFSNRLSALAATHAL 314

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Lt+++W g+dL++++eae+ Py ++++R+ ++G
CP000943_6 315 --LTEAQWHGVDLHKVVEAEVMPYQNAGQPRVIIEGAY 350

CP000943_1582: domain 1 of 1, from 629 to 715: score 118.7, E = 4.5e-40
*->ELnHRVKNtLAvVQSiarQTlR..naasldefveaFsgRLqALsraH
ELnHRVKNtLA+VQSia Q+lR+ + ++ + +++aF +RL AL+raH
CP000943_1 629 ELNHRVKNTLATVQSIAMQSLRrlRGREAEGARDAFVARLIALARAH 675

dLVpLtrseWagAdLreLleaeLaPygge.d.aeRitlsGPd<-*
d+ Ltr++W+gA+L+e+++ ++aP +g++++++R+ + GP+
CP000943_1 676 DV--LTRESWEGAELAEVVAGAVAPLEGPrGrRPRFSVAGPP 715

CP000943_0793: domain 1 of 1, from 318 to 400: score 103.7, E = 6.1e-35
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR KN+++vVQS++rQT +a+s+++f +a++ RL L+++++L
CP000943_0 318 ELSHRAKNLFTVVQSLIRQTGASAPSVAAFQDALTERLSGLAASQSL 364

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L+++e++g L+ L++++La + + ++Ri+++GP+
CP000943_0 365 --LVEHEGSGTPLGLLVSRQLASFVAMPDPRIRIEGPE 400

CP000943_5312: domain 1 of 1, from 195 to 277: score 99.4, E = 1.8e-33
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR +N LAv Q+++ T+R ++s+de+ +aFs+R+++L+r++ L
CP000943_5 195 ELHHRTRNNLAVLQALFGVTARASGSVDELYRAFSDRIASLARTQAL 241

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L+++ W+ ++L +Ll++e++ + ++d +R++l+GP+
CP000943_5 242 --LSDDYWQTVRLDDLLAHEFEWHLSHDTGRVVLDGPE 277

CP000943_5301: domain 1 of 1, from 196 to 278: score 91.7, E = 7e-31
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR +N LAv Q+++ ++R ++s++++ +Fs+R+++L+r+++L
CP000943_5 196 ELHHRTRNNLAVLQALFGASARASRSVNDLYHSFSDRIASLARTQSL 242

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L+++ W+ A L+++l++e++ + + +R+tl GP+
CP000943_5 243 --LSDDYWQTAGLHDILSHEFEWHISISNGRVTLNGPE 278

CP000943_3419: domain 1 of 1, from 456 to 537: score 86.3, E = 5e-29
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRV+N++A++ S+ + T+ +a + +++e +sgRL+AL+r++ L
CP000943_3 456 ELQHRVRNIMAMIRSVTARTADTAMHVRDYAELLSGRLMALARTQAL 502

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Ltr+ g++ +L++aeL++ +++ +++ lsGP+
CP000943_3 503 --LTRAANLGVEVDALVRAELEAQAQD-PGQYDLSGPP 537

CP000943_5890: domain 2 of 2, from 861 to 944: score 82.2, E = 1.2e-27
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRV+NtLAv S++r T+ +++s++++++ ++gR+ A +r+++
CP000943_5 861 ELQHRVRNTLAVMRSVVRRTALSSDSVEDYAAHLEGRIDAFARVQSA 907

VpLtrseWagAdLreLleaeLaPyggedaeRi.tlsGPd<-*
+tr+ +ag dL +L+++eL +++++ +e++++++GP+
CP000943_5 908 --VTRDPAAGIDLEQLVSHELLAHAAHEGEQVrRIEGPP 944


Histogram of all scores:
score obs exp (one = represents 21 sequences)
----- --- ---
-14 14 0|=
-13 88 0|=====
-12 384 0|===================
-11 518 54|==*======================
-10 797 683|================================*=====
-9 1173 1691|======================================================== *
-8 1236 1756|==========================================================*
-7 862 1179|========================================== *
-6 573 643|============================ *
-5 380 319|===============*===
-4 249 151|=======*====
-3 129 70|===*===
-2 86 32|=*===
-1 44 14|*==
0 23 6|*=
1 14 3|*
2 6 1|*
3 6 0|=
4 5 0|=
5 0 0|
6 2 0|=
7 1 0|=
8 1 0|=
9 0 0|
10 0 0|
11 1 0|=
12 0 0|
13 0 0|
> 14 17 -|=


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 4721.1826
P(chi-square) = 0

Total sequences searched: 6609

Whole sequence top hits:
tophits_s report:
Total hits: 13
Satisfying E cutoff: 13
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 13
Satisfying E cutoff: 13
Total memory: 26K


Acknowledgements:

This research is funded by:

Developed by: