Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
264 projects found  

1 accessions found for Pseudomonas putida W619  

Data for CP000949  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000949.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000949_4763 CDS_5284397-5282010 65.5 6.5e-19 1
CP000949_1643 CDS_1826342-1825452 63.8 2e-18 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000949_4763 1/1 599 666 .. 1 70 [] 65.5 6.5e-19
CP000949_1643 1/1 87 151 .. 1 70 [] 63.8 2e-18

Alignments of top-scoring domains:
CP000949_4763: domain 1 of 1, from 599 to 666: score 65.5, E = 6.5e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E aRIARE HD++gQ+L+++kl +++++ ++ ++ ++++ e+l+ +
CP000949_4 599 EKARIAREVHDELGQMLTVLKLEVSMCELAF--AELDPALNERLASM 643

relarealaevRrllgdLRpaal<-*
++l+ + + vR+++++LRp++l
CP000949_4 644 KRLIAQLFQLVRDVATALRPPIL 666

CP000949_1643: domain 1 of 1, from 87 to 151: score 63.8, E = 2e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER++++RELHD +gQ L+a+klqle+++ ++ p ++++ ++
CP000949_1 87 ERQHLSRELHDDIGQLLTAAKLQLEWLQ-----RRLPSDVQAQCGTL 128

relarealaevRrllgdLRpaal<-*
+++++l+ vR++ L p +l
CP000949_1 129 CSTLDDTLSKVRDVSALLNPRQL 151


Histogram of all scores:
score obs exp (one = represents 16 sequences)
----- --- ---
-14 8 0|=
-13 66 0|=====
-12 118 57|===*====
-11 198 474|============= *
-10 591 1102|===================================== *
-9 931 1251|==========================================================*
-8 789 964|================================================== *
-7 714 606|=====================================*=======
-6 561 343|=====================*==============
-5 455 184|===========*=================
-4 269 96|=====*===========
-3 168 49|===*=======
-2 126 25|=*======
-1 66 12|*====
0 42 6|*==
1 34 3|*==
2 14 1|*
3 14 0|=
4 5 0|=
5 4 0|=
6 0 0|
7 0 0|
8 2 0|=
9 2 0|=
10 0 0|
11 0 0|
> 12 5 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 2540.8403
P(chi-square) = 0

Total sequences searched: 5182

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: