hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP000949.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000949_2562 CDS_2859549-2857015 102.0 1.8e-34 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000949_2562 1/1 520 600 .. 1 85 [] 102.0 1.8e-34
Alignments of top-scoring domains:
CP000949_2562: domain 1 of 1, from 520 to 600: score 102.0, E = 1.8e-34
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKN+L+++ +++++ +++l+ +v+++ gR+qALs aHd+
CP000949_2 520 ELNHRVKNILSLIGALVAHPTSEHQTLNGYVATLKGRIQALSLAHDQ 566
VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
++r + +g++++ LleaeL+Py++ a+ ++l+GP+
CP000949_2 567 --VVRGD-GGGRFANLLEAELSPYRTS-ADALVLTGPA 600
Histogram of all scores:
score obs exp (one = represents 17 sequences)
----- --- ---
-14 9 0|=
-13 65 0|====
-12 417 0|=========================
-11 560 42|==*==============================
-10 788 535|===============================*===============
-9 897 1326|===================================================== *
-8 965 1376|========================================================= *
-7 576 924|================================== *
-6 374 504|====================== *
-5 229 250|==============*
-4 132 118|======*=
-3 86 55|===*==
-2 40 25|=*=
-1 28 11|*=
0 7 5|*
1 2 2|*
2 2 1|*
> 3 5 -|=
% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 6926.8862
P(chi-square) = 0
Total sequences searched: 5182
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K