Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
76 projects found  

3 accessions found for Burkholderia cenocepacia MC0-3  

Data for CP000959  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP000959.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP000959_2768 CDS_3185356-3187458 68.6 4.4e-20 1
CP000959_1363 CDS_1553890-1552508 66.4 1.9e-19 1
CP000959_0736 CDS_852649-854445 53.6 1.1e-15 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP000959_2768 1/1 487 559 .. 1 70 [] 68.6 4.4e-20
CP000959_1363 1/1 253 323 .. 1 70 [] 66.4 1.9e-19
CP000959_0736 1/1 382 449 .. 1 70 [] 53.6 1.1e-15

Alignments of top-scoring domains:
CP000959_2768: domain 1 of 1, from 487 to 559: score 68.6, E = 4.4e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrllds...dkdpeeareal
E +RIARELHD +gQ+L+a+k+ l++++++l+ ++++ ++e ++++l
CP000959_2 487 EKTRIARELHDDLGQQLTALKMDLSVVEQQLRMpgrAQPDEGVQTHL 533

deirelarealaevRrllgdLRpaal<-*
+ +r+l++ + a vRr++ dLRp l
CP000959_2 534 QGMRRLIDATVASVRRIAADLRPVML 559

CP000959_1363: domain 1 of 1, from 253 to 323: score 66.4, E = 1.9e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe...eareal
ERaR++RELHD+++Q++ ++kl+le a++++ ++ + +ea++al
CP000959_1 253 ERARLSRELHDGISQMMVSAKLMLESALARF--ERGTSrvpEAEQAL 297

deirelarealaevRrllgdLRpaal<-*
+ + + ++l+evRr+ ++LRp+ l
CP000959_1 298 ASGVGRLGDTLREVRRISHALRPSML 323

CP000959_0736: domain 1 of 1, from 382 to 449: score 53.6, E = 1.1e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RIARELHD+++Q+L+ +k le++ ++ + d++ +++ ++++
CP000959_0 382 EQRRIARELHDELAQTLATLKNDLEWLIDHV--PQDDASLARKIAAM 426

relarealaevRrllgdLRpaal<-*
++lar a a +Rr+++dLRp l
CP000959_0 427 HALARGAVAATRRIASDLRPLML 449


Histogram of all scores:
score obs exp (one = represents 9 sequences)
----- --- ---
-14 5 0|=
-13 26 0|===
-12 52 31|===*==
-11 87 256|========== *
-10 273 594|=============================== *
-9 502 674|======================================================== *
-8 421 520|=============================================== *
-7 419 327|====================================*==========
-6 302 185|====================*=============
-5 280 99|==========*=====================
-4 163 51|=====*=============
-3 93 26|==*========
-2 58 13|=*=====
-1 44 6|*====
0 26 3|*==
1 16 1|*=
2 9 0|=
3 6 0|=
4 2 0|=
5 2 0|=
6 1 0|=
7 2 0|=
8 1 0|=
9 1 0|=
> 10 4 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1537.6263
P(chi-square) = 0

Total sequences searched: 2795

Whole sequence top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: