Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

9 accessions found for Methylobacterium radiotolerans JCM 2831  

Data for CP001001  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP001001.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001001_2741 CDS_2923960-2922896 108.1 2.1e-30 1
CP001001_3671 CDS_3963086-3960471 100.8 2.3e-28 1
CP001001_1502 CDS_1615713-1616957 85.6 4.9e-24 1
CP001001_0607 CDS_669503-668499 82.2 4.7e-23 1
CP001001_4890 CDS_5283346-5282255 70.4 1e-19 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001001_2741 1/1 162 248 .. 1 94 [] 108.1 2.1e-30
CP001001_3671 1/1 679 762 .. 1 94 [] 100.8 2.3e-28
CP001001_1502 1/1 207 287 .. 1 77 [. 85.6 4.9e-24
CP001001_0607 1/1 142 228 .. 1 94 [] 82.2 4.7e-23
CP001001_4890 1/1 171 254 .. 1 94 [] 70.4 1e-19

Alignments of top-scoring domains:
CP001001_2741: domain 1 of 1, from 162 to 248: score 108.1, E = 2.1e-30
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E++HRV N+L+++++L +Q ++d+++ ++aL E q R+ +
CP001001_2 162 EVNHRVANSLALVAALAHMQRNAVTDPAA-----KAALDEMQARISA 203

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A iH++LY+s+d+++v++++Yl+ L+e+L +++ ++ ++ ++ l
CP001001_2 204 IAGIHRRLYTSDDVESVELDAYLQSLVEELQAAMRASGRDHAIR--L 248

CP001001_3671: domain 1 of 1, from 679 to 762: score 100.8, E = 2.3e-28
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EI HRVKN+LQ++S+ L +Q r++ d e+ + a+ ++ RV+S
CP001001_3 679 EIDHRVKNSLQIVSAFLQMQRRQIADGEA-----RQAFADTSARVMS 720

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A +H+ LY+ + +d vd+++ +e L+++L ++g+g +D+
CP001001_3 721 VARVHDSLYQADRFDEVDLGQTIESLCNDLAGLAGDGHA-----VDM 762

CP001001_1502: domain 1 of 1, from 207 to 287: score 85.6, E = 4.9e-24
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+ HRVKN+L++++SLL LQar ++d++v + aL ++++RV +
CP001001_1 207 EMSHRVKNSLAIVASLLALQARAAEDPAV-----QTALADARSRVEA 248

mAliHEeLYkse.........dldtvdfseYlekLtenL<-*
+A +H++L++ +++ ++++++ + +d++++lekL++nL
CP001001_1 249 IAGVHDQLWRQGdkaegegegVPGELDLAPFLEKLVANL 287

CP001001_0607: domain 1 of 1, from 142 to 228: score 82.2, E = 4.7e-23
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+ HRVKNNLQvISSL L ar++ + e+ ++aL+ R+ +
CP001001_0 142 EVDHRVKNNLQVISSLMLLKARRTPEGEA-----RDALQGMAERIGA 183

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
++ H++LY +d +++++ + ++++ g++ ++ ++++D+
CP001001_0 184 LSTAHRMLYSEGDCTHFNLGDFAAEFLADMNA--GLDPERRRVEADV 228

CP001001_4890: domain 1 of 1, from 171 to 254: score 70.4, E = 1e-19
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+ HRV+NNLQv+ SL+ L r + d + + ++ +RV++
CP001001_4 171 EVYHRVRNNLQVMVSLIGLYGRAAPDA-C-----RGSFEALGQRVRA 211

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+Al++++L++ + ++d+++Yl +L++ L q+ + g++g++ +
CP001001_4 212 IALVQQHLHEAPHIASIDLKDYLHRLASGLGQLRRAGRIGVQ----V 254


Histogram of all scores:
score obs exp (one = represents 29 sequences)
----- --- ---
-15 24 0|=
-14 71 0|===
-13 167 35|=*====
-12 426 373|============*==
-11 1693 1039|===================================*=======================
-10 1233 1345|=========================================== *
-9 805 1136|============================ *
-8 577 762|==================== *
-7 271 452|========== *
-6 220 252|========*
-5 90 135|====*
-4 40 71|==*
-3 29 37|=*
-2 6 19|*
-1 9 10|*
0 3 5|*
1 2 2|*
2 1 1|*
3 1 0|=
4 1 0|=
> 5 17 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 1172.4481
P(chi-square) = 0

Total sequences searched: 5686

Whole sequence top hits:
tophits_s report:
Total hits: 5
Satisfying E cutoff: 5
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 5
Satisfying E cutoff: 5
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: