Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

9 accessions found for Methylobacterium radiotolerans JCM 2831  

Data for CP001001  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP001001.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001001_3282 CDS_3534350-3532839 136.9 2.5e-46 1
CP001001_2058 CDS_2221498-2220380 128.7 1.6e-43 1
CP001001_1273 CDS_1360037-1358271 128.4 2e-43 1
CP001001_3003 CDS_3215325-3218330 125.5 1.9e-42 1
CP001001_2790 CDS_2982978-2980762 124.0 6.3e-42 1
CP001001_5164 CDS_5557838-5559553 122.1 2.7e-41 1
CP001001_4434 CDS_4775901-4777616 119.2 2.8e-40 1
CP001001_1304 CDS_1393362-1394402 117.1 1.4e-39 1
CP001001_1519 CDS_1634152-1636080 116.6 2.1e-39 1
CP001001_3367 CDS_3628623-3629864 104.1 3.6e-35 1
CP001001_4175 CDS_4489922-4488432 84.2 2.2e-28 1
CP001001_4369 CDS_4711789-4708313 71.0 7.1e-24 1
CP001001_3921 CDS_4227461-4225554 68.7 4.4e-23 2

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001001_3282 1/1 305 387 .. 1 85 [] 136.9 2.5e-46
CP001001_2058 1/1 167 250 .. 1 85 [] 128.7 1.6e-43
CP001001_1273 1/1 397 471 .. 1 85 [] 128.4 2e-43
CP001001_3003 1/1 804 886 .. 1 85 [] 125.5 1.9e-42
CP001001_2790 1/1 525 611 .. 1 85 [] 124.0 6.3e-42
CP001001_5164 1/1 372 449 .. 1 85 [] 122.1 2.7e-41
CP001001_4434 1/1 369 456 .. 1 85 [] 119.2 2.8e-40
CP001001_1304 1/1 151 233 .. 1 85 [] 117.1 1.4e-39
CP001001_1519 1/1 413 521 .. 1 85 [] 116.6 2.1e-39
CP001001_3367 1/1 221 303 .. 1 85 [] 104.1 3.6e-35
CP001001_4175 1/1 294 377 .. 1 85 [] 84.2 2.2e-28
CP001001_4369 1/1 972 1053 .. 1 85 [] 71.0 7.1e-24
CP001001_3921 1/2 441 485 .. 1 45 [. 63.8 2e-21

Alignments of top-scoring domains:
CP001001_3282: domain 1 of 1, from 305 to 387: score 136.9, E = 2.5e-46
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKN++A+ QSia+QTlRnaasl+e+++++++RL++Ls+aHd+
CP001001_3 305 ELNHRVKNSMATMQSIAHQTLRNAASLEEAHRTLDARLHSLSAAHDV 351

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Ltr++W gA+L ++e +L++++g +++R+ + GPd
CP001001_3 352 --LTRESWIGATLNVIVEGTLQAFRGGASQRFLINGPD 387

CP001001_2058: domain 1 of 1, from 167 to 250: score 128.7, E = 1.6e-43
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKNtLA+VQSia+QT+R+ ++ + ++ F++R +ALs+aH++
CP001001_2 167 ELNHRVKNTLATVQSIAAQTFRGQTDQTA-RAVFDARMAALSNAHNV 212

VpLtrseWagAdLreLleaeLaPygge..daeRitlsGPd<-*
L++++W++A+Lr ++e++LaP+ ++ d++R++l+GPd
CP001001_2 213 --LVEDNWESASLRSVVERALAPHLLAevDPGRFRLQGPD 250

CP001001_1273: domain 1 of 1, from 397 to 471: score 128.4, E = 2e-43
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKNtLA+VQ++arQ+ + ++e +++R+ ALs +HdL
CP001001_1 397 ELNHRVKNTLATVQALARQS----RGSAE---VLEARILALSKTHDL 436

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Ltr++W+gA Lre+le+eL+Py++ ++++i+l+GPd
CP001001_1 437 --LTREDWSGAPLREVLESELGPYRT-GGDQIRLDGPD 471

CP001001_3003: domain 1 of 1, from 804 to 886: score 125.5, E = 1.9e-42
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKNtLA+VQ+ia+QT+Rnaa+ld++++aFs+RL L+raHd+
CP001001_3 804 ELQHRVKNTLAMVQAIANQTFRNAADLDAARDAFSARLILLGRAHDI 850

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Ltr++W A +++++ +La + g +++Ri++sGP
CP001001_3 851 --LTRASWTEAPIADVVDGALAVHQGGAGTRIRVSGPG 886

CP001001_2790: domain 1 of 1, from 525 to 611: score 124.0, E = 6.3e-42
*->ELnHRVKNtLAvVQSiarQTlRn..aasldefveaFsgRLqALsraH
ELnHRVKNtLA+VQSia+Q+lR+ + a+ d++++aF++RL AL+r+H
CP001001_2 525 ELNHRVKNTLATVQSIAAQSLRGleGAEADAARAAFEARLLALARVH 571

dLVpLtrseWagAdLreLleaeLaPygged..aeRitlsGPd<-*
d+ Ltr++W+gA+L+++++ +++P ++ d++ R+++sGP+
CP001001_2 572 DV--LTRESWEGAELSAVVADAIRPLEAGDgrTSRFQVSGPA 611

CP001001_5164: domain 1 of 1, from 372 to 449: score 122.1, E = 2.7e-41
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKNtLA+VQS+arQ + +e ++++++R+ ALs +HdL
CP001001_5 372 ELNHRVKNTLATVQSLARQA----RGGEEQAAQLEARILALSKTHDL 414

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Ltr++W gA+Lr+++e eL+Py++ +++ itl+GPd
CP001001_5 415 --LTREDWTGASLRDVMENELSPYRT-GDDHITLDGPD 449

CP001001_4434: domain 1 of 1, from 369 to 456: score 119.2, E = 2.8e-40
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKNtLA+VQ+i+ T+R+a s+++f eaF gR+ +L+ +H++
CP001001_4 369 ELHHRVKNTLATVQAIVGSTARTASSIESFYEAFVGRIKSLAHTHSV 415

VpLtrseWagAdLreLleaeLaPygged.....aeRitlsGPd<-*
Lt++ W+ A+L+ Ll+ eL Py+ +++++ ++Ri l+GP+
CP001001_4 416 --LTEDTWQTASLANLLRNELKPYAEVApdggaEGRISLDGPA 456

CP001001_1304: domain 1 of 1, from 151 to 233: score 117.1, E = 1.4e-39
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKNtLA+VQ++ ++R+a+s+d+f ++Fs+R +L+ +H+L
CP001001_1 151 ELHHRVKNTLATVQALLGASARSATSVDAFYASFSARVISLAKTHNL 197

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Lt++ W+ A Lr+ l eL+Py++ + Ri+l+GP+
CP001001_1 198 --LTEDYWQQAPLRDMLMNELGPYNDVEGARIQLDGPA 233

CP001001_1519: domain 1 of 1, from 413 to 521: score 116.6, E = 2.1e-39
*->ELnHRVKNtLAvVQSiarQTlRn.aasldefveaFsgRLqALsraHd
ELnHRVKNtLA+VQ++a+Q+l+n a ++ ++aF++RL ALsraHd
CP001001_1 413 ELNHRVKNTLATVQAMAAQSLKNlGAGAAAGRDAFEARLLALSRAHD 459

LVpLtrseWagAdLreLleaeLaPygged.....................
+ Ltr++Wa+AdLr +++++++P+ g+ + +++++++++++++++++++
CP001001_1 460 I--LTRESWASADLRGIAAQAVRPFLGPEpaggdpsnrdssgretsdrdt 507

....aeRitlsGPd<-*
+ + +Ritl+GPd
CP001001_1 508 lganTPRITLDGPD 521

CP001001_3367: domain 1 of 1, from 221 to 303: score 104.1, E = 3.6e-35
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL HR KNt+A+VQ++a+QT Rna+sl+++ ea+++RL AL+ aHd+
CP001001_3 221 ELAHRMKNTMAMVQAVAAQTMRNAPSLEAAGEALAARLLALAKAHDV 267

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L + + A+L+ L+e +++ +g+ a+R+++ GPd
CP001001_3 268 --LLQGSFTRASLSGLVEGAVSLHGDGVAGRFRIAGPD 303

CP001001_4175: domain 1 of 1, from 294 to 377: score 84.2, E = 2.2e-28
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR +N+L vV Sia QT +++ + f+++F +RL ALsr+++L
CP001001_4 294 ELQHRTRNLLGVVRSIAKQTMAQTGPGETFRQRFNDRLSALSRVQGL 340

VpLtrseWagAdLreLleaeLaPygged.aeRitlsGPd<-*
L+rs+ ++ +Lr L+e eLa+ ++++ + Ri+l+GP
CP001001_4 341 --LSRSDQEPITLRSLIETELAALDAPAmQARIRLHGPV 377

CP001001_4369: domain 1 of 1, from 972 to 1053: score 71.0, E = 7.1e-24
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E+nHRVKN++A++ +++ +R+++++ f+++ ++R+ AL+raH+L
CP001001_4 972 EMNHRVKNLFAIIGGMISAGARTHREIGVFATDMRDRISALGRAHSL 1018

Vp.LtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
+ ++ + ++ dL+ L+ a+L+Py++ + +++GP
CP001001_4 1019 -AdPSDGQ-GMSDLAGLIGATLRPYRD--HVPTVIEGPL 1053

CP001001_3921: domain 1 of 2, from 441 to 485: score 63.8, E = 2e-21
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraH<-
EL+HR+KN++AvV ++a+ T+R+ + + fv+aF+ RL AL+raH
CP001001_3 441 ELSHRIKNIFAVVGGLATLTARTDPAAKPFVAAFRERLGALARAH 485

*

CP001001_3 - -


Histogram of all scores:
score obs exp (one = represents 18 sequences)
----- --- ---
-14 11 0|=
-13 78 0|=====
-12 375 0|=====================
-11 454 46|==*=======================
-10 673 588|================================*=====
-9 993 1455|======================================================== *
-8 1057 1510|==========================================================*
-7 770 1014|=========================================== *
-6 489 553|============================ *
-5 310 274|===============*==
-4 185 130|=======*===
-3 105 60|===*==
-2 66 27|=*==
-1 48 12|*==
0 22 5|*=
1 19 2|*=
2 5 1|*
3 1 0|=
4 3 0|=
5 0 0|
6 0 0|
7 1 0|=
8 1 0|=
9 0 0|
10 1 0|=
> 11 19 -|==


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 4192.2842
P(chi-square) = 0

Total sequences searched: 5686

Whole sequence top hits:
tophits_s report:
Total hits: 13
Satisfying E cutoff: 13
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 13
Satisfying E cutoff: 13
Total memory: 26K


Acknowledgements:

This research is funded by:

Developed by: