Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

3 accessions found for   

Data for CP001016  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP001016.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001016_2992 CDS_3532246-3530519 101.8 1.4e-34 1
CP001016_0698 CDS_794146-797718 96.3 1.1e-32 1
CP001016_1318 CDS_1547579-1548649 85.1 7e-29 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001016_2992 1/1 385 467 .. 1 85 [] 101.8 1.4e-34
CP001016_0698 1/1 987 1068 .. 1 85 [] 96.3 1.1e-32
CP001016_1318 1/1 161 229 .. 1 71 [. 85.1 7e-29

Alignments of top-scoring domains:
CP001016_2992: domain 1 of 1, from 385 to 467: score 101.8, E = 1.4e-34
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRV+NtLA+VQ++++ T++++as+++f +aF+gR+++L+ +H
CP001016_2 385 ELHHRVRNTLAIVQGVMNTTAKSSASIEDFQAAFAGRIASLAKTHAA 431

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
+t++ +++++r Ll +eL+Pyg + ++Ri lsGP+
CP001016_2 432 --MTEELQQSVEFRHLLVQELEPYGLDRGGRIMLSGPA 467

CP001016_0698: domain 1 of 1, from 987 to 1068: score 96.3, E = 1.1e-32
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKN+LA+V++++ QTl+++ ++++f++ ++gR+ A aH+L
CP001016_0 987 ELDHRVKNILAIVSAVVSQTLKTSSTPEAFAAEIEGRIKAITMAHSL 1033

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Lt++ + +Lr+++e eLaPy+ e + + ++G d
CP001016_0 1034 --LTQAGQGTMSLRAVIETELAPYRRE-NGNFIITGRD 1068

CP001016_1318: domain 1 of 1, from 161 to 229: score 85.1, E = 7e-29
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E+nHR+KN+LAvVQ+i+ T+R+ +++f F++R+ A + a++L
CP001016_1 161 EMNHRIKNSLAVVQAIMSLTARTCVNPADFQSVFTARIGAFAKAQSL 207

VpLtrseWagAdLreLleaeLaPy<-*
L +++W+ +L ++++ LaP+
CP001016_1 208 --LNDEHWQTIRLDAVVAGILAPH 229


Histogram of all scores:
score obs exp (one = represents 12 sequences)
----- --- ---
-14 1 0|=
-13 52 0|=====
-12 289 0|=========================
-11 358 29|==*===========================
-10 537 369|==============================*==============
-9 653 913|======================================================= *
-8 656 948|======================================================= *
-7 440 637|===================================== *
-6 230 347|==================== *
-5 161 172|==============*
-4 78 81|======*
-3 52 37|===*=
-2 25 17|=*=
-1 14 7|*=
0 6 3|*
1 8 1|*
2 2 0|=
3 3 0|=
> 4 4 -|=


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 4062.8760
P(chi-square) = 0

Total sequences searched: 3569

Whole sequence top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: