Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

3 accessions found for Beijerinckia indica subsp. indica ATCC 9039  

Data for CP001017  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP001017.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001017_0140 CDS_145669-142166 142.9 6.9e-50 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001017_0140 1/1 974 1056 .. 1 85 [] 142.9 6.9e-50

Alignments of top-scoring domains:
CP001017_0140: domain 1 of 1, from 974 to 1056: score 142.9, E = 6.9e-50
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL HR KNtL+v+QSia+QTlR+++s ++fve+F+gRL+AL++aH L
CP001017_0 974 ELTHRMKNTLTVIQSIAHQTLRTTTSGADFVERFEGRLHALANAHKL 1020

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L++s+W+gA+L++L++ +L++y g+d++ ++++G++
CP001017_0 1021 --LVESRWEGAELGALAQGQLEAYIGNDSGKLRIEGES 1056


Histogram of all scores:
score obs exp (one = represents 1 sequences)
----- --- ---
-14 2 0|==
-13 4 0|====
-12 22 0|======================
-11 33 1|*================================
-10 36 18|=================*==================
-9 19 45|=================== *
-8 24 46|======================== *
-7 15 31|=============== *
-6 8 17|======== *
-5 3 8|=== *
-4 3 4|===*
-3 2 1|*=
-2 0 0|
-1 1 0|=
0 1 0|=
1 0 0|
2 1 0|=
3 0 0|
4 0 0|
> 5 2 -|==


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 57.0047
P(chi-square) = 1.234e-11

Total sequences searched: 176

Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: