hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP001025.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001025_1222 CDS_1361223-1366214 132.4 1.3e-37 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001025_1222 1/1 1468 1556 .. 1 94 [] 132.4 1.3e-37
Alignments of top-scoring domains:
CP001025_1222: domain 1 of 1, from 1468 to 1556: score 132.4, E = 1.3e-37
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHRVKNNLQ+ISSLL+LQa+++++++v e++ +s+nRV+S
CP001025_1 1468 EVHHRVKNNLQLISSLLNLQAERVTNKAV-----AELFADSRNRVRS 1509
mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mA++HE LY+ +++ ++ + + ++ L+++L + y g+ g++L D+
CP001025_1 1510 MAMVHENLYRAGNFARIAMTAHVKTLCGHLARVYDMGRLGVDLQIDV 1556
Histogram of all scores:
score obs exp (one = represents 15 sequences)
----- --- ---
-15 11 0|=
-14 23 0|==
-13 45 19|=*=
-12 192 201|=============*
-11 833 562|=====================================*==================
-10 727 727|================================================*
-9 465 614|=============================== *
-8 348 412|======================== *
-7 163 244|=========== *
-6 153 136|=========*=
-5 54 73|====*
-4 27 38|==*
-3 15 20|=*
-2 7 10|*
-1 6 5|*
0 3 2|*
> 1 2 -|=
% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 252.6417
P(chi-square) = 0
Total sequences searched: 3074
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K