Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
76 projects found  

4 accessions found for Burkholderia ambifaria MC40-6  

Data for CP001026  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001026.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001026_1136 CDS_1307358-1305304 67.4 8e-20 1
CP001026_2364 CDS_2748429-2749808 66.2 1.8e-19 1
CP001026_0388 CDS_429607-427817 57.4 7.5e-17 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001026_1136 1/1 471 543 .. 1 70 [] 67.4 8e-20
CP001026_2364 1/1 253 323 .. 1 70 [] 66.2 1.8e-19
CP001026_0388 1/1 383 450 .. 1 70 [] 57.4 7.5e-17

Alignments of top-scoring domains:
CP001026_1136: domain 1 of 1, from 471 to 543: score 67.4, E = 8e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrllds...dkdpeeareal
E +RIARELHD +gQ+L+a+k+ l++++++l+ ++++ +++ + +l
CP001026_1 471 EKTRIARELHDDLGQQLTALKMDLSVIEQQLRApgrAQPNDDVLSHL 517

deirelarealaevRrllgdLRpaal<-*
+ +r+l++ + a vRr++ dLRp l
CP001026_1 518 QGMRRLIDATVASVRRIAADLRPVML 543

CP001026_2364: domain 1 of 1, from 253 to 323: score 66.2, E = 1.8e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe...eareal
ER+R++RELHD+++Q++ ++kl+le a++++ ++ + + +ea++al
CP001026_2 253 ERERLSRELHDGISQMMVSAKLMLESALARF--ERGATrmpEAEQAL 297

deirelarealaevRrllgdLRpaal<-*
++ + + ++l+evRr+ ++LRpa l
CP001026_2 298 ATGVGRLGDTLREVRRISHALRPAML 323

CP001026_0388: domain 1 of 1, from 383 to 450: score 57.4, E = 7.5e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RIARELHD+++Q+L+ +k le+++ ++ + d++++++ ++++
CP001026_0 383 EQRRIARELHDELAQTLATLKNDLEWLLDHV--PQDDAPLARKIAAM 427

relarealaevRrllgdLRpaal<-*
++lar a + +Rr+++dLRp l
CP001026_0 428 HALARGAVTATRRIASDLRPLML 450


Histogram of all scores:
score obs exp (one = represents 7 sequences)
----- --- ---
-14 7 0|=
-13 21 0|===
-12 38 26|===*==
-11 76 218|=========== *
-10 289 506|========================================== *
-9 377 575|====================================================== *
-8 379 443|======================================================= *
-7 338 278|=======================================*=========
-6 276 157|======================*=================
-5 242 84|===========*=======================
-4 130 44|======*============
-3 84 22|===*========
-2 40 11|=*====
-1 30 5|*====
0 19 3|*==
1 11 1|*=
2 6 0|=
3 7 0|=
4 4 0|=
5 1 0|=
6 2 0|=
7 1 0|=
8 0 0|
> 9 4 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1162.5951
P(chi-square) = 0

Total sequences searched: 2382

Whole sequence top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: