Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

3 accessions found for Methylobacterium populi BJ001  

Data for CP001029  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP001029.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001029_4464 CDS_4868819-4871443 110.5 3.9e-31 1
CP001029_4939 CDS_5400592-5399447 106.6 5.1e-30 1
CP001029_5310 CDS_5793013-5791967 103.1 5e-29 1
CP001029_3675 CDS_3974007-3975227 96.2 4.6e-27 1
CP001029_4421 CDS_4825261-4824161 87.4 1.5e-24 1
CP001029_0489 CDS_541963-540884 70.1 1.2e-19 1
CP001029_4595 CDS_5013548-5014642 65.2 3e-18 1
CP001029_4026 CDS_4386102-4384741 51.4 2.5e-14 1
CP001029_3432 CDS_3711534-3710470 40.3 3.6e-11 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001029_4464 1/1 685 768 .. 1 94 [] 110.5 3.9e-31
CP001029_4939 1/1 191 273 .. 1 94 [] 106.6 5.1e-30
CP001029_5310 1/1 156 242 .. 1 94 [] 103.1 5e-29
CP001029_3675 1/1 212 297 .. 1 94 [] 96.2 4.6e-27
CP001029_4421 1/1 172 258 .. 1 94 [] 87.4 1.5e-24
CP001029_0489 1/1 157 240 .. 1 94 [] 70.1 1.2e-19
CP001029_4595 1/1 162 244 .. 1 94 [] 65.2 3e-18
CP001029_4026 1/1 261 346 .. 1 94 [] 51.4 2.5e-14
CP001029_3432 1/1 163 211 .. 1 54 [. 40.3 3.6e-11

Alignments of top-scoring domains:
CP001029_4464: domain 1 of 1, from 685 to 768: score 110.5, E = 3.9e-31
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EI HRVKN+LQ++++ L +Q r++ d+e+ + a+ E+ RV+S
CP001029_4 685 EIDHRVKNSLQIVTAFLHMQRRQIADPEA-----RQAFSETSARVMS 726

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A +H+ LY++e++++vd+++ ++ L+++L g++ + ++ l
CP001029_4 727 VARVHDSLYQGESMEQVDLGQTIQTLCNDLAGMTGDEHS---VE--L 768

CP001029_4939: domain 1 of 1, from 191 to 273: score 106.6, E = 5.1e-30
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+ HRVKN+L+v+++LL LQar +++e+v + aL +++ RV +
CP001029_4 191 EMSHRVKNSLAVVAGLLALQARGAENENV-----KSALADARARVEA 232

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A++H++L++ dl ++d++ +le L+e L +s+g + + +
CP001029_4 233 VAQVHDQLWRQPDLTQIDVAGFLEALCEKLTESAGAHALR------C 273

CP001029_5310: domain 1 of 1, from 156 to 242: score 103.1, E = 5e-29
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E++HRV N+L ++++L r+Q+ + d+++ + aL+E q R+ +
CP001029_5 156 EVNHRVANSLTLVAALARMQTNAVADPAA-----KQALEEMQARISA 197

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A iH++LY+s d++ v++++Yl L+e+L ++ ++ ++ ++ l
CP001029_5 198 IAGIHRRLYTSQDVEAVELDAYLAGLVEELQLAMKASGRDHAIR--L 242

CP001029_3675: domain 1 of 1, from 212 to 297: score 96.2, E = 4.6e-27
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EI HRVKN+L+v+++LL++Q + d++ ++aL ++q RVl+
CP001029_3 212 EISHRVKNSLAVVAGLLSMQGGTAIDPAL-----RAALLDAQARVLT 253

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A +H++L++ +++++d++e+l++L+ +L+ s g ++ + +++
CP001029_3 254 IAKVHDQLWRRNEVENLDLAEFLQELCVQLRASTGP---NHTIACEV 297

CP001029_4421: domain 1 of 1, from 172 to 258: score 87.4, E = 1.5e-24
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+ HRVKNNLQvISSL L ar++ + ++ ++aL+ +R+ +
CP001029_4 172 EVDHRVKNNLQVISSLMLLKARRTPEGDA-----RDALQAMADRIGA 213

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
++ H++LY +d+++ df+e+ L+++L ++ +i+ + +
CP001029_4 214 LSTAHRMLYSEGDVSRFDFREFTADLIADLAAGLDEERTRIETE--V 258

CP001029_0489: domain 1 of 1, from 157 to 240: score 70.1, E = 1.2e-19
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EI HRV+NNLQv+ SL+ L r + + + + + +RV++
CP001029_0 157 EIYHRVRNNLQVMVSLIGLYGRAAPEA-C-----RGSFDALGQRVRA 197

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+Al++++L++ + ++d+++Yl +L++ L q+ + g++g+ +
CP001029_0 198 IALVQQHLHEAPHIASIDLRDYLHRLASGLGQLRRAGRIGVT----I 240

CP001029_4595: domain 1 of 1, from 162 to 244: score 65.2, E = 3e-18
*->EIHHRVKNNLQvISSLLrLQarkfkd..eevikdEVleaLrEsqnRV
E +HRV NN+Q +++LL LQ rk+ ++++++ + ++ E+q R
CP001029_4 162 ELQHRVANNMQFVAALLALQKRKVAEnpQAA-----IGVFDEAQTRL 203

lSmAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<
++A iH++LY + +++Yl++L+++L+++ g +++ +
CP001029_4 204 ETIARIHRRLYDPAR-ADQPIGQYLQELCSDLLDATGARNI-------V 244

-*

CP001029_4 - -

CP001029_4026: domain 1 of 1, from 261 to 346: score 51.4, E = 2.5e-14
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E HR+KN+LQ+I+S ++ + r++ ++ v e r q+R+ +
CP001029_4 261 ELAHRIKNSLQIITSFVSYEIRRAAEPCV------EGYRAMQGRIGA 301

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A +++ ++s l+ v +++Yle ++++L++s + +i ++ +
CP001029_4 302 VAELYDVISRSSTLGPVAMGPYLEGIAGSLRSSLLGAEARIAVD--V 346

CP001029_3432: domain 1 of 1, from 163 to 211: score 40.3, E = 3.6e-11
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EI HR N LQ+IS++L LQ+ +++d++v ++aL E+++RV +
CP001029_3 163 EIGHRAGNDLQMISAMLTLQSSNSRDPAV-----RAALAEAIGRVEA 204

mAliHEe<-*
++++
CP001029_3 205 LGALYRQ 211


Histogram of all scores:
score obs exp (one = represents 27 sequences)
----- --- ---
-15 22 0|=
-14 50 0|==
-13 147 33|=*====
-12 429 349|============*===
-11 1559 971|===================================*======================
-10 1071 1257|======================================== *
-9 767 1062|============================= *
-8 539 712|==================== *
-7 298 423|============ *
-6 212 235|========*
-5 78 127|=== *
-4 54 67|==*
-3 35 35|=*
-2 16 18|*
-1 9 9|*
0 5 4|*
1 2 2|*
2 1 1|*
3 1 0|=
4 1 0|=
5 2 0|=
> 6 16 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 975.1766
P(chi-square) = 0

Total sequences searched: 5314

Whole sequence top hits:
tophits_s report:
Total hits: 9
Satisfying E cutoff: 9
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 9
Satisfying E cutoff: 9
Total memory: 24K


Acknowledgements:

This research is funded by:

Developed by: