Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

3 accessions found for Methylobacterium populi BJ001  

Data for CP001029  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001029.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001029_3762 CDS_4074774-4076192 55.0 8.2e-16 1
CP001029_3689 CDS_3992948-3995014 42.8 3.3e-12 1
CP001029_4761 CDS_5192278-5191106 40.7 1.4e-11 1
CP001029_4866 CDS_5310780-5312300 39.4 3.2e-11 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001029_3762 1/1 263 330 .. 1 70 [] 55.0 8.2e-16
CP001029_3689 1/1 479 548 .. 1 70 [] 42.8 3.3e-12
CP001029_4761 1/1 188 249 .. 1 70 [] 40.7 1.4e-11
CP001029_4866 1/1 279 350 .. 1 70 [] 39.4 3.2e-11

Alignments of top-scoring domains:
CP001029_3762: domain 1 of 1, from 263 to 330: score 55.0, E = 8.2e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER +IARELHD v+Q+L+a++ + ++ + + ++++ ++ +e+
CP001029_3 263 ERSHIARELHDDVAQRLTALTFLARSIEDGV--GTTAPKVSAESAEL 307

relarealaevRrllgdLRpaal<-*
++a +++ +R++lg+LRp++
CP001029_3 308 VAMAAVTMRSLRDTLGHLRPPEI 330

CP001029_3689: domain 1 of 1, from 479 to 548: score 42.8, E = 3.3e-12
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe..eareald
E +RIARELHD vgQ+ ++++l+l +++rll d+ + ea ++++
CP001029_3 479 EQRRIARELHDQVGQTVTGLSLGLKGLERLL--DAQETsaEAGRQIQ 523

eirelarealaevRrllgdLRpaal<-*
+++la e +++ r++ dLRp+al
CP001029_3 524 WLQRLAGEIGRDIHRAAVDLRPTAL 548

CP001029_4761: domain 1 of 1, from 188 to 249: score 40.7, E = 1.4e-11
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ +ARELHD+ gQ+L+ +kl l+++rr + p e+++ l+++
CP001029_4 188 ERECLARELHDEAGQQLAWLKLRLDRLRR----APSPTEVEAMLKQV 230

relarealaevRrllgdLRpaal<-*
+++ a +R+++++LRp++l
CP001029_4 231 DAIS----ASLRQVVRELRPGTL 249

CP001029_4866: domain 1 of 1, from 279 to 350: score 39.4, E = 3.2e-11
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe....earea
ERaRIA ELHD+ g L+a+ + ++rl+ + + + ++++++ +
CP001029_4 279 ERARIALELHDEFGPCLFALEANAASVARLA--AMPGDidrsRLASR 323

ldeirelarealaevRrllgdLRpaal<-*
+ i ++ + ++ R+ll +LRp +l
CP001029_4 324 AGDIGSIVGQVQTLNRDLLNRLRPHGL 350


Histogram of all scores:
score obs exp (one = represents 15 sequences)
----- --- ---
-14 5 0|=
-13 50 0|====
-12 112 59|===*====
-11 170 487|============ *
-10 527 1130|==================================== *
-9 865 1283|==========================================================*
-8 759 989|=================================================== *
-7 740 621|=========================================*========
-6 619 351|=======================*==================
-5 564 188|============*=========================
-4 335 98|======*================
-3 205 50|===*==========
-2 147 25|=*========
-1 75 13|*====
0 58 6|*===
1 27 3|*=
2 20 1|*=
3 14 0|=
4 3 0|=
5 7 0|=
6 1 0|=
7 1 0|=
8 1 0|=
9 0 0|
10 2 0|=
11 0 0|
12 1 0|=
13 0 0|
14 0 0|
> 15 6 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 4022.3088
P(chi-square) = 0

Total sequences searched: 5314

Whole sequence top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: