Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

3 accessions found for Methylobacterium populi BJ001  

Data for CP001029  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP001029.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001029_0165 CDS_185231-182538 136.7 2.7e-46 1
CP001029_1106 CDS_1206161-1203153 127.5 3.6e-43 1
CP001029_3454 CDS_3731234-3729483 125.5 1.8e-42 1
CP001029_0783 CDS_860517-859051 121.2 5.1e-41 1
CP001029_0160 CDS_177064-178074 120.3 1e-40 1
CP001029_1951 CDS_2123964-2126105 115.9 3.2e-39 1
CP001029_4273 CDS_4664190-4661386 109.0 7.2e-37 1
CP001029_0300 CDS_340238-337533 105.8 9.6e-36 1
CP001029_2022 CDS_2211911-2213878 97.7 5.5e-33 1
CP001029_2039 CDS_2233109-2230620 87.1 2.2e-29 1
CP001029_0091 CDS_95869-98658 86.4 3.9e-29 1
CP001029_0833 CDS_902515-905889 84.2 2.1e-28 1
CP001029_1272 CDS_1398880-1395374 70.7 8.4e-24 1
CP001029_4955 CDS_5416941-5420276 65.1 6.7e-22 1
CP001029_0295 CDS_329485-332934 63.6 2.1e-21 1
CP001029_2846 CDS_3107127-3107828 63.3 2.7e-21 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001029_0165 1/1 698 780 .. 1 85 [] 136.7 2.7e-46
CP001029_1106 1/1 804 886 .. 1 85 [] 127.5 3.6e-43
CP001029_3454 1/1 385 472 .. 1 85 [] 125.5 1.8e-42
CP001029_0783 1/1 297 379 .. 1 85 [] 121.2 5.1e-41
CP001029_0160 1/1 147 227 .. 1 85 [] 120.3 1e-40
CP001029_1951 1/1 500 586 .. 1 85 [] 115.9 3.2e-39
CP001029_4273 1/1 734 816 .. 1 85 [] 109.0 7.2e-37
CP001029_0300 1/1 714 793 .. 1 85 [] 105.8 9.6e-36
CP001029_2022 1/1 454 537 .. 1 85 [] 97.7 5.5e-33
CP001029_2039 1/1 640 719 .. 1 85 [] 87.1 2.2e-29
CP001029_0091 1/1 737 818 .. 1 85 [] 86.4 3.9e-29
CP001029_0833 1/1 926 1009 .. 1 85 [] 84.2 2.1e-28
CP001029_1272 1/1 983 1061 .. 1 85 [] 70.7 8.4e-24
CP001029_4955 1/1 768 849 .. 1 85 [] 65.1 6.7e-22
CP001029_0295 1/1 969 1050 .. 1 85 [] 63.6 2.1e-21
CP001029_2846 1/1 32 114 .. 1 85 [] 63.3 2.7e-21

Alignments of top-scoring domains:
CP001029_0165: domain 1 of 1, from 698 to 780: score 136.7, E = 2.7e-46
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKNtLA+VQ+ia QTlR+a++++e++eaF++RL +L+raHd+
CP001029_0 698 ELQHRVKNTLALVQAIASQTLRGANDVNEMREAFAARLISLGRAHDI 744

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Lt+++W A ++e++e +L+ ++++ a Ri++sGP+
CP001029_0 745 --LTQANWTEAPIGEVAEGALSVHRQAEASRIRISGPN 780

CP001029_1106: domain 1 of 1, from 804 to 886: score 127.5, E = 3.6e-43
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKNtLA+VQ+ia QT+Rna ++++++eaF++RL +L+raHd+
CP001029_1 804 ELQHRVKNTLALVQAIASQTFRNALDPEAAREAFAARLISLGRAHDI 850

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Ltrs+W A e++e +La ++g+ Ri+ sGP+
CP001029_1 851 --LTRSSWTEAPVLEVVEGALAVHRGATTARIRASGPA 886

CP001029_3454: domain 1 of 1, from 385 to 472: score 125.5, E = 1.8e-42
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKNtLA+VQ+i+ T+R+a+s+d+f+eaF gR+ +L+ +H++
CP001029_3 385 ELHHRVKNTLATVQAIVGSTARTATSIDSFHEAFVGRIKSLAHTHSV 431

VpLtrseWagAdLreLleaeLaPygged.....aeRitlsGPd<-*
Lt++ W+ A+Lr+Ll++eL Py+ ++++++ Ri+l+GP+
CP001029_3 432 --LTEATWQTASLRDLLASELMPYAESEtetspDLRIVLDGPP 472

CP001029_0783: domain 1 of 1, from 297 to 379: score 121.2, E = 5.1e-41
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E+ HRVKN++A+VQSia+QTlRnaasld++++++++RL +L+ aHd+
CP001029_0 297 EMKHRVKNSIATVQSIAHQTLRNAASLDDARRTLDARLNSLATAHDI 343

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Lt + gA+L+e +e++L+P++ + Ri++ GP+
CP001029_0 344 --LTSEATTGATLAEAVESALQPFRVSPRNRIRVGGPE 379

CP001029_0160: domain 1 of 1, from 147 to 227: score 120.3, E = 1e-40
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKNtLA+VQ++++ T+R++ s++ef +aFsgR+ +L+r+H L
CP001029_0 147 ELHHRVKNTLATVQAVVNATARSSLSVAEFTRAFSGRIGSLARTHAL 193

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
+t++ ++ A++ Ll+aeL+Py+ ++R+tl+GP
CP001029_0 194 --ITEDLAQAASFEGLLRAELDPYDE--RRRLTLEGPK 227

CP001029_1951: domain 1 of 1, from 500 to 586: score 115.9, E = 3.2e-39
*->ELnHRVKNtLAvVQSiarQTlRn..aasldefveaFsgRLqALsraH
ELnHRVKNtLA+VQSia Q+lR+ + ++ +++++aF++RL AL+raH
CP001029_1 500 ELNHRVKNTLATVQSIAMQSLRGleGEEAQSAKAAFEARLLALARAH 546

dLVpLtrseWagAdLreLleaeLaPygged..aeRitlsGPd<-*
d+ Ltr++W+gA+L+ +++ +++P ++ +++ R+ +sGP+
CP001029_1 547 DV--LTRESWEGAELKTVVADAIRPLEAGEgqESRFAVSGPR 586

CP001029_4273: domain 1 of 1, from 734 to 816: score 109.0, E = 7.2e-37
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR KNtL++ Q+ia QTlRn +++ ++ea+ +RL+AL+ aHd+
CP001029_4 734 ELSHRLKNTLTMAQAIASQTLRNVSDIAVAKEALVARLVALGKAHDI 780

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L e++gA L ++++ +La +++ ++Ri+lsGP+
CP001029_4 781 --LLSGEGEGAALEAVIAGALAIHDDGEPGRIHLSGPA 816

CP001029_0300: domain 1 of 1, from 714 to 793: score 105.8, E = 9.6e-36
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR KNt+A+V Sia+QTlR + s veaF+ R+qAL++aHdL
CP001029_0 714 ELSHRLKNTMAMVVSIAHQTLR-SVSERGPVEAFEKRIQALASAHDL 759

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L r +W AdLr ++++ L+ + a+R+tl+GPd
CP001029_0 760 --LLRKDWTAADLRSVCREVLGTAAE--ARRFTLDGPD 793

CP001029_2022: domain 1 of 1, from 454 to 537: score 97.7, E = 5.5e-33
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR +N+L vV Sia+QT +++ + f+e+Fs+RL+ALsr+++L
CP001029_2 454 ELQHRTRNLLGVVRSIAHQTMVQTGPTERFREQFSDRLAALSRVQGL 500

VpLtrseWagAdLreLleaeLaPygge.daeRitlsGPd<-*
L+rs+ ++ +Lr L++ eL++ gg + a+Ri+l GP+
CP001029_2 501 --LSRSDQEPITLRTLIQTELDALGGGeFADRIHLGGPP 537

CP001029_2039: domain 1 of 1, from 640 to 719: score 87.1, E = 2.2e-29
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL HR KNtLA+VQSia+ TlR + e veaF+ R ALsraHd+
CP001029_2 640 ELAHRLKNTLAIVQSIAASTLR-GVTEREPVEAFERRVLALSRAHDV 685

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L + +W+ A++r+++e+ L +++ d +R+ l+GPd
CP001029_2 686 --LMQKSWSAARMRAVMESVL--CMQTDMDRFALDGPD 719

CP001029_0091: domain 1 of 1, from 737 to 818: score 86.4, E = 3.9e-29
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR KN+LA+VQ+ia+QT R+a+++++ ea+ +RL AL+ aHd+
CP001029_0 737 ELSHRMKNILAMVQAIAAQTMRGATDVAAVGEALGDRLIALGKAHDV 783

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L ++ A L++++++ ++ +++ ++R+ sGP+
CP001029_0 784 --LLGGAAERAPLAAIVREGVGVQEAA-SGRVLYSGPE 818

CP001029_0833: domain 1 of 1, from 926 to 1009: score 84.2, E = 2.1e-28
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR +N+++vV S+a QT ++as++ f+++F +RL Lsr+++L
CP001029_0 926 ELQHRTRNLITVVRSLAEQTMARSASMEVFRRQFYDRLSVLSRVQGL 972

VpLtrseWagAdLreLleaeLaPygge.daeRitlsGPd<-*
L+rs ++ +L++L++ eL++ g+ ++a+Ri l+GP+
CP001029_0 973 --LSRSGIEPITLHALISTELDALGAGeAADRIYLEGPS 1009

CP001029_1272: domain 1 of 1, from 983 to 1061: score 70.7, E = 8.4e-24
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR++N+L vV S+a+ T + ve+F+ RL AL+ra+ L
CP001029_1 983 ELQHRSRNLLGVVTSLATRT----VGQGAPVESFTTRLNALGRAQAL 1025

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L+rs ++ +L+ aeLa+y + +a+Ri +sGP+
CP001029_1 1026 --LSRSGNDTVEVNALVHAELAAYTSGAAQRIKISGPR 1061

CP001029_4955: domain 1 of 1, from 768 to 849: score 65.1, E = 6.7e-22
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRV+N++Av Si++ T +a+s+ e++ + gRL L+r++ L
CP001029_4 768 ELQHRVRNIMAVTRSIVARTGERAESVSEYASLVGGRLLTLARVQAL 814

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Ltrs ag+ + ++ e+++ + +++ lsGP+
CP001029_4 815 --LTRSANAGVPVATIVHDEIDAQALR-EDQYDLSGPE 849

CP001029_0295: domain 1 of 1, from 969 to 1050: score 63.6, E = 2.1e-21
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E+nHRVKN++A++ ++++ +R+ ++++ f+ + + R++AL+raH+L
CP001029_0 969 EMNHRVKNLFAIIGGMITAGARSQRDVATFAHDMRERIAALGRAHSL 1015

Vp.LtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
+ t ++ + dL L+ a+L+Py++ + t++GP+
CP001029_0 1016 -AdHTTDQ-GISDLTSLVGATLQPYRD--HIPTTIEGPP 1050

CP001029_2846: domain 1 of 1, from 32 to 114: score 63.3, E = 2.7e-21
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL H V+NtL++ +i+r ++ +++sl+ +v+ ++gRL AL+r+ +
CP001029_2 32 ELRHKVRNTLSMLRAIIRRSAETSDSLETYVAHLDGRLDALARVLNA 78

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L rs +g L+ L++ eL + + +e++ +sGP+
CP001029_2 79 --LMRSVPEGIGLHSLVADELLVHLAREGEQVAISGPS 114


Histogram of all scores:
score obs exp (one = represents 17 sequences)
----- --- ---
-14 19 0|==
-13 67 0|====
-12 335 0|====================
-11 477 43|==*==========================
-10 693 549|================================*========
-9 917 1360|====================================================== *
-8 980 1412|==========================================================*
-7 697 948|========================================= *
-6 428 517|========================== *
-5 299 256|===============*==
-4 155 121|=======*==
-3 91 56|===*==
-2 70 25|=*===
-1 25 11|*=
0 21 5|*=
1 9 2|*
2 7 1|*
> 3 24 -|==


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 4895.8853
P(chi-square) = 0

Total sequences searched: 5314

Whole sequence top hits:
tophits_s report:
Total hits: 16
Satisfying E cutoff: 16
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 16
Satisfying E cutoff: 16
Total memory: 27K


Acknowledgements:

This research is funded by:

Developed by: