Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
25 projects found  

1 accessions found for Opitutus terrae PB90-1  

Data for CP001032  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_1.hmm [HisKA]
Sequence database: CP001032.Gprot.fsa
per-sequence score cutoff: >= 26.8 [TC1]
per-domain score cutoff: >= 26.8 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA
Accession: PF00512.12
Description: His Kinase A (phosphoacceptor) domain
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001032_0772 CDS_944251-948930 130.2 1.7e-36 2
CP001032_0091 CDS_111568-115509 102.0 1.6e-28 1
CP001032_0905 CDS_1119980-1117350 101.7 2e-28 1
CP001032_2207 CDS_2856039-2853601 101.3 2.6e-28 1
CP001032_2159 CDS_2789503-2785889 98.1 2.1e-27 1
CP001032_3902 CDS_5090466-5092742 96.2 7.5e-27 1
CP001032_0804 CDS_983207-985996 95.8 9.3e-27 1
CP001032_1711 CDS_2109324-2113097 90.9 2.3e-25 1
CP001032_3821 CDS_4990951-4989179 89.6 5.4e-25 1
CP001032_0366 CDS_445683-443596 89.3 6.5e-25 1
CP001032_2413 CDS_3117793-3118842 89.2 7.1e-25 1
CP001032_0829 CDS_1018676-1016628 89.2 7.1e-25 1
CP001032_3769 CDS_4918547-4920367 88.4 1.2e-24 1
CP001032_0954 CDS_1173087-1175291 87.8 1.7e-24 1
CP001032_4227 CDS_5480525-5484367 86.1 5.2e-24 1
CP001032_2144 CDS_2759096-2757189 86.0 5.6e-24 1
CP001032_2541 CDS_3283687-3284892 84.3 1.7e-23 1
CP001032_3838 CDS_5008441-5009577 83.2 3.4e-23 1
CP001032_2824 CDS_3621798-3618904 83.0 4e-23 1
CP001032_1636 CDS_2019506-2021299 77.8 1.2e-21 1
CP001032_1132 CDS_1421609-1415919 74.3 1.1e-20 1
CP001032_0364 CDS_442091-439281 73.7 1.7e-20 1
CP001032_3060 CDS_3998275-4000344 72.1 4.9e-20 1
CP001032_1831 CDS_2288660-2287224 71.2 8.8e-20 1
CP001032_0037 CDS_47264-50395 70.1 1.8e-19 1
CP001032_3560 CDS_4656349-4654142 67.0 1.3e-18 1
CP001032_0818 CDS_1005394-1004111 64.7 6.1e-18 1
CP001032_0775 CDS_951454-953718 62.6 2.3e-17 1
CP001032_1608 CDS_1984332-1986095 60.3 1.1e-16 1
CP001032_0261 CDS_291890-290385 58.3 4e-16 1
CP001032_2922 CDS_3757733-3760153 57.7 6.1e-16 1
CP001032_1401 CDS_1770130-1771506 56.9 1e-15 1
CP001032_0942 CDS_1163906-1161936 56.7 1.1e-15 1
CP001032_1099 CDS_1368549-1370144 54.6 4.3e-15 1
CP001032_1228 CDS_1526241-1527962 54.5 4.8e-15 1
CP001032_2930 CDS_3767806-3769896 53.7 7.9e-15 1
CP001032_1131 CDS_1415723-1413573 53.4 9.6e-15 1
CP001032_3727 CDS_4870181-4868742 52.4 1.9e-14 1
CP001032_1309 CDS_1627876-1626443 52.3 1.9e-14 1
CP001032_1803 CDS_2250233-2253490 52.3 2e-14 1
CP001032_3545 CDS_4636832-4634694 51.3 3.9e-14 1
CP001032_1720 CDS_2125983-2127482 50.7 5.6e-14 1
CP001032_0461 CDS_546768-548696 50.1 8.6e-14 1
CP001032_1995 CDS_2575834-2574086 49.8 1e-13 1
CP001032_4116 CDS_5347010-5349145 49.5 1.3e-13 1
CP001032_4051 CDS_5272035-5273129 49.4 1.4e-13 1
CP001032_0315 CDS_374901-373486 48.6 2.2e-13 1
CP001032_1328 CDS_1642509-1646345 48.6 2.2e-13 1
CP001032_0365 CDS_443599-442088 48.4 2.6e-13 1
CP001032_3287 CDS_4319876-4322113 46.0 1.2e-12 1
CP001032_0723 CDS_897288-895576 43.7 5.3e-12 1
CP001032_2841 CDS_3645900-3641884 43.3 7.2e-12 1
CP001032_3023 CDS_3892126-3894447 42.9 9.3e-12 1
CP001032_1522 CDS_1896041-1898494 40.6 4.2e-11 1
CP001032_3059 CDS_3994472-3998140 40.4 4.8e-11 1
CP001032_1270 CDS_1583542-1584288 40.1 5.7e-11 1
CP001032_1739 CDS_2153210-2157568 39.4 8.9e-11 1
CP001032_0805 CDS_986114-987217 39.4 8.9e-11 1
CP001032_0963 CDS_1185026-1188559 39.3 9.4e-11 1
CP001032_0929 CDS_1150209-1147927 39.2 1e-10 1
CP001032_1475 CDS_1845146-1843713 38.5 1.6e-10 1
CP001032_0384 CDS_464735-468763 38.5 1.6e-10 1
CP001032_1838 CDS_2297773-2295416 38.5 1.6e-10 1
CP001032_0771 CDS_943143-944243 38.3 1.8e-10 1
CP001032_2461 CDS_3178045-3183078 38.1 2.1e-10 1
CP001032_2090 CDS_2692147-2693334 36.9 4.7e-10 1
CP001032_2397 CDS_3095804-3097792 36.5 6e-10 1
CP001032_0941 CDS_1161696-1158916 34.7 1.9e-09 1
CP001032_1123 CDS_1407361-1404392 34.6 2.1e-09 1
CP001032_0845 CDS_1038212-1039768 32.8 6.9e-09 1
CP001032_1182 CDS_1483946-1481907 31.5 1.6e-08 1
CP001032_4450 CDS_5762334-5760301 31.1 2e-08 1
CP001032_4010 CDS_5225073-5227613 30.5 3.1e-08 1
CP001032_1905 CDS_2401654-2404101 30.0 4.1e-08 1
CP001032_0955 CDS_1175288-1176406 28.2 1.4e-07 1
CP001032_0172 CDS_208725-211199 27.5 2.1e-07 1
CP001032_2151 CDS_2772763-2771630 27.2 2.6e-07 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001032_0091 1/1 794 859 .. 1 87 [] 102.0 1.6e-28
CP001032_0905 1/1 358 423 .. 1 87 [] 101.7 2e-28
CP001032_2207 1/1 282 347 .. 1 87 [] 101.3 2.6e-28
CP001032_2159 1/1 820 885 .. 1 87 [] 98.1 2.1e-27
CP001032_3902 1/1 229 294 .. 1 87 [] 96.2 7.5e-27
CP001032_0804 1/1 472 538 .. 1 87 [] 95.8 9.3e-27
CP001032_1711 1/1 807 873 .. 1 87 [] 90.9 2.3e-25
CP001032_3821 1/1 90 155 .. 1 87 [] 89.6 5.4e-25
CP001032_0366 1/1 331 399 .. 1 87 [] 89.3 6.5e-25
CP001032_2413 1/1 111 176 .. 1 87 [] 89.2 7.1e-25
CP001032_0829 1/1 165 230 .. 1 87 [] 89.2 7.1e-25
CP001032_3769 1/1 233 298 .. 1 87 [] 88.4 1.2e-24
CP001032_0954 1/1 230 296 .. 1 87 [] 87.8 1.7e-24
CP001032_4227 1/1 784 849 .. 1 87 [] 86.1 5.2e-24
CP001032_2144 1/1 247 313 .. 1 87 [] 86.0 5.6e-24
CP001032_2541 1/1 164 231 .. 1 87 [] 84.3 1.7e-23
CP001032_3838 1/1 152 220 .. 1 87 [] 83.2 3.4e-23
CP001032_2824 1/1 444 509 .. 1 87 [] 83.0 4e-23
CP001032_0772 1/2 360 429 .. 1 87 [] 79.3 4.5e-22
CP001032_1636 1/1 373 441 .. 1 87 [] 77.8 1.2e-21
CP001032_1132 1/1 1228 1296 .. 1 87 [] 74.3 1.1e-20
CP001032_0364 1/1 559 624 .. 1 87 [] 73.7 1.7e-20
CP001032_3060 1/1 318 384 .. 1 87 [] 72.1 4.9e-20
CP001032_1831 1/1 251 317 .. 1 87 [] 71.2 8.8e-20
CP001032_0037 1/1 810 878 .. 1 87 [] 70.1 1.8e-19
CP001032_3560 1/1 353 419 .. 1 87 [] 67.0 1.3e-18
CP001032_0818 1/1 192 257 .. 1 87 [] 64.7 6.1e-18
CP001032_0775 1/1 374 440 .. 1 87 [] 62.6 2.3e-17
CP001032_1608 1/1 360 426 .. 1 87 [] 60.3 1.1e-16
CP001032_0261 1/1 259 326 .. 1 87 [] 58.3 4e-16
CP001032_2922 1/1 434 500 .. 1 87 [] 57.7 6.1e-16
CP001032_1401 1/1 229 295 .. 1 87 [] 56.9 1e-15
CP001032_0942 1/1 427 495 .. 1 87 [] 56.7 1.1e-15
CP001032_1099 1/1 159 225 .. 1 87 [] 54.6 4.3e-15
CP001032_1228 1/1 196 262 .. 1 87 [] 54.5 4.8e-15
CP001032_2930 1/1 320 386 .. 1 87 [] 53.7 7.9e-15
CP001032_1131 1/1 336 402 .. 1 87 [] 53.4 9.6e-15
CP001032_3727 1/1 251 319 .. 1 87 [] 52.4 1.9e-14
CP001032_1309 1/1 255 320 .. 1 87 [] 52.3 1.9e-14
CP001032_1803 1/1 704 770 .. 1 87 [] 52.3 2e-14
CP001032_3545 1/1 343 408 .. 1 87 [] 51.3 3.9e-14
CP001032_0772 2/2 1178 1244 .. 1 87 [] 50.9 4.8e-14
CP001032_1720 1/1 275 341 .. 1 87 [] 50.7 5.6e-14
CP001032_0461 1/1 268 334 .. 1 87 [] 50.1 8.6e-14
CP001032_1995 1/1 351 417 .. 1 87 [] 49.8 1e-13
CP001032_4116 1/1 339 405 .. 1 87 [] 49.5 1.3e-13
CP001032_4051 1/1 1 60 [. 9 87 .] 49.4 1.4e-13
CP001032_0315 1/1 255 313 .. 1 87 [] 48.6 2.2e-13
CP001032_1328 1/1 910 976 .. 1 87 [] 48.6 2.2e-13
CP001032_0365 1/1 276 343 .. 1 87 [] 48.4 2.6e-13
CP001032_3287 1/1 380 446 .. 1 87 [] 46.0 1.2e-12
CP001032_0723 1/1 331 395 .. 1 87 [] 43.7 5.3e-12
CP001032_2841 1/1 960 1026 .. 1 87 [] 43.3 7.2e-12
CP001032_3023 1/1 410 476 .. 1 87 [] 42.9 9.3e-12
CP001032_1522 1/1 448 514 .. 1 87 [] 40.6 4.2e-11
CP001032_3059 1/1 842 907 .. 1 87 [] 40.4 4.8e-11
CP001032_1270 1/1 24 90 .. 1 82 [. 40.1 5.7e-11
CP001032_1739 1/1 1087 1153 .. 1 87 [] 39.4 8.9e-11
CP001032_0805 1/1 135 201 .. 1 87 [] 39.4 8.9e-11
CP001032_0963 1/1 793 859 .. 1 87 [] 39.3 9.4e-11
CP001032_0929 1/1 386 451 .. 1 87 [] 39.2 1e-10
CP001032_1475 1/1 240 306 .. 1 87 [] 38.5 1.6e-10
CP001032_0384 1/1 967 1033 .. 1 87 [] 38.5 1.6e-10
CP001032_1838 1/1 417 483 .. 1 87 [] 38.5 1.6e-10
CP001032_0771 1/1 137 204 .. 1 87 [] 38.3 1.8e-10
CP001032_2461 1/1 1305 1371 .. 1 87 [] 38.1 2.1e-10
CP001032_2090 1/1 164 238 .. 1 87 [] 36.9 4.7e-10
CP001032_2397 1/1 443 509 .. 1 87 [] 36.5 6e-10
CP001032_0941 1/1 551 616 .. 1 87 [] 34.7 1.9e-09
CP001032_1123 1/1 613 678 .. 1 87 [] 34.6 2.1e-09
CP001032_0845 1/1 152 218 .. 1 87 [] 32.8 6.9e-09
CP001032_1182 1/1 469 525 .. 11 87 .] 31.5 1.6e-08
CP001032_4450 1/1 469 525 .. 11 87 .] 31.1 2e-08
CP001032_4010 1/1 477 538 .. 1 82 [. 30.5 3.1e-08
CP001032_1905 1/1 436 502 .. 1 87 [] 30.0 4.1e-08
CP001032_0955 1/1 143 211 .. 1 87 [] 28.2 1.4e-07
CP001032_0172 1/1 452 518 .. 1 87 [] 27.5 2.1e-07
CP001032_2151 1/1 144 210 .. 1 87 [] 27.2 2.6e-07

Alignments of top-scoring domains:
CP001032_0091: domain 1 of 1, from 794 to 859: score 102.0, E = 1.6e-28
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aks+fla++sHE+RTP+++++g+++lL e t+ls+eq
CP001032_0 794 AKSDFLASMSHEIRTPMNGVIGMTSLLME---------TDLSPEQ-- 829

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r++++ti+ ++e ll +ind+Ld+s+ie+g
CP001032_0 830 ----------RDFVNTIRTSGEALLTIINDILDFSKIESG 859

CP001032_0905: domain 1 of 1, from 358 to 423: score 101.7, E = 2e-28
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ak++fla++sHE RTPL++I g+a+lLle tel++eq
CP001032_0 358 AKGQFLATMSHEVRTPLNGIVGFASLLLE---------TELTPEQ-- 393

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
ey+eti+ ++e l +L d+Ld++rie+g
CP001032_0 394 ----------LEYVETIRTSSETLIQLTGDILDYARIESG 423

CP001032_2207: domain 1 of 1, from 282 to 347: score 101.3, E = 2.6e-28
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
akseflan+sHE+RTP+++++g++ lLl+ t+l++eq
CP001032_2 282 AKSEFLANMSHEIRTPMNGVIGMTGLLLD---------TKLDPEQ-- 317

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r++ e+++++ae l ind+Ld+s+ieag
CP001032_2 318 ----------RQFAESVRNSAENLMTVINDILDFSKIEAG 347

CP001032_2159: domain 1 of 1, from 820 to 885: score 98.1, E = 2.1e-27
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ak++flan+sHE+RTP+++++g++ lL + t+l++eq
CP001032_2 820 AKNQFLANMSHEIRTPMNGVIGMSNLLVD---------TPLGPEQ-- 855

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ey + i+++ae ll++ind+Ld s++eag
CP001032_2 856 ----------QEYAQAIRHSAEALLAIINDILDVSKLEAG 885

CP001032_3902: domain 1 of 1, from 229 to 294: score 96.2, E = 7.5e-27
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aks flan+sHE+RTP+++++g+a lLl+ t+l++eq
CP001032_3 229 AKSVFLANMSHEIRTPMNGVLGMANLLLA---------TPLNPEQ-- 264

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+++ et+ +++e+ll +ind+Ld+s+ieag
CP001032_3 265 ----------HDLAETLCQSGESLLTIINDILDFSKIEAG 294

CP001032_0804: domain 1 of 1, from 472 to 538: score 95.8, E = 9.3e-27
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aks+fla++sHELRTPL++I+gy+++L++ d+ l+e+q
CP001032_0 472 AKSQFLASVSHELRTPLNGILGYTQILRR--------DPLLGEKQ-- 508

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
re +++i+++ae+ll Lind+Ldls+ieag
CP001032_0 509 ----------REGIRVIHESAEHLLVLINDVLDLSKIEAG 538

CP001032_1711: domain 1 of 1, from 807 to 873: score 90.9, E = 2.3e-25
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aks fla++sHELRTPL++++gya++L + +++ ++ +
CP001032_1 807 AKSTFLAHMSHELRTPLNGVLGYAQVLAR---------DPAQPPAA- 843

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
re l++i++++e+ll+Lin++Ldl+r eag
CP001032_1 844 ----------RERLQIIIQSGEHLLALINEVLDLARVEAG 873

CP001032_3821: domain 1 of 1, from 90 to 155: score 89.6, E = 5.4e-25
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
k+efla++sHE+RTPL++++g+++lLl t+l++ q
CP001032_3 90 VKTEFLATMSHEIRTPLNGVLGTVDLLLG---------TPLTPAQ-- 125

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+yl ti+ +ae l++ +dlLd+s++e+g
CP001032_3 126 ----------GDYLATIRTSAEALRAVTDDLLDFSKLEQG 155

CP001032_0366: domain 1 of 1, from 331 to 399: score 89.3, E = 6.5e-25
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aksefl+++sHELRTPL+a++g+ae Lle ag++ +
CP001032_0 331 AKSEFLSTMSHELRTPLNAVIGLAESLLE------AGEAMEAARV-- 369

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r+yle+i+ ++++ll++ind+Ldl+rieag
CP001032_0 370 ----------RRYLEIIHTSGRQLLAQINDILDLARIEAG 399

CP001032_2413: domain 1 of 1, from 111 to 176: score 89.2, E = 7.1e-25
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aks fla+lsHE+RTP+++++g a lL++ t+l++eq
CP001032_2 111 AKSLFLAYLSHEIRTPVNGVIGVANLLRD---------TALNPEQ-- 146

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+e++et++ ++ ll+++nd+Ldl++ie+g
CP001032_2 147 ----------AELVETLQVSSAALLAILNDVLDLAKIESG 176

CP001032_0829: domain 1 of 1, from 165 to 230: score 89.2, E = 7.1e-25
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aks fla++sHE+RTPL++++g++ +L++ tel++eq
CP001032_0 165 AKSAFLAMMSHEIRTPLNGVIGMTGVLEA---------TELDDEQ-- 200

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
re l+ti+ ++e ll+ +nd Ld+s+ieag
CP001032_0 201 ----------RECLRTIKMSGEALLAVVNDTLDYSKIEAG 230

CP001032_3769: domain 1 of 1, from 233 to 298: score 88.4, E = 1.2e-24
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aks+fla++sHE+RTP+++I+g++++L + l+ eq
CP001032_3 233 AKSDFLATMSHEIRTPMNGIMGMLQVLHG---------SSLTVEQ-- 268

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r +e++ ++ae+l rL+nd+Ld+s+ie+g
CP001032_3 269 ----------RAQVEIAGNSAESLMRLLNDILDFSKIESG 298

CP001032_0954: domain 1 of 1, from 230 to 296: score 87.8, E = 1.7e-24
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+k+ flan+sHE+RTP++aI+g+++lL + el+++ ++
CP001032_0 230 EKNAFLANMSHEIRTPMNAILGFSDLLAT----------ELPADSKA 266

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r+ ++ i+++a +ll+Lind+Ldls+i+ag
CP001032_0 267 ----------RQRVRAIRESATSLLQLINDILDLSKIDAG 296

CP001032_4227: domain 1 of 1, from 784 to 849: score 86.1, E = 5.2e-24
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
akseflan+sHE+R+P+++I g++ +++e t+lse q
CP001032_4 784 AKSEFLANMSHEIRNPISGIVGLSLAIEE---------TPLSERQ-- 819

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r++ ++i+++a l L++d+Ld+s+ieag
CP001032_4 820 ----------RQIADSIRSCASLLATLVDDVLDFSKIEAG 849

CP001032_2144: domain 1 of 1, from 247 to 313: score 86.0, E = 5.6e-24
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
akseflan+sHE+RTPL++I++ a+l+ +++l++e
CP001032_2 247 AKSEFLANMSHEIRTPLNGIIASADLMIQ--------RADLPAEA-- 283

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
re + i ++++ ll+L+ d+Ld+s+ieag
CP001032_2 284 ----------REHARLITQSGDLLLNLLGDILDFSKIEAG 313

CP001032_2541: domain 1 of 1, from 164 to 231: score 84.3, E = 1.7e-23
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++f+an+sHELRTPL+ I+ +ae+Ll+++ + ++
CP001032_2 164 IRQDFVANVSHELRTPLSLIKSAAETLLDGG-------KNDPAVN-- 201

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+++le+i++ a+rl+ Li+dlL+ls+++a+
CP001032_2 202 ----------ARFLEIIDKHANRLSLLIDDLLTLSKLDAE 231

CP001032_3838: domain 1 of 1, from 152 to 220: score 83.2, E = 3.4e-23
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ak++fl +++H+LR+PL++Irg+ae L++++ ++ls++q
CP001032_3 152 AKNKFLGMAAHDLRNPLASIRGLAEFLRDGV------VGPLSADQ-- 190

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++++ti+ +++++l ++n+lLd + ieag
CP001032_3 191 ----------LDLVQTIHAASQSMLTMVNELLDVATIEAG 220

CP001032_2824: domain 1 of 1, from 444 to 509: score 83.0, E = 4e-23
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aks+fla +sHELRTPL++++g ++lL++ + ++ +
CP001032_2 444 AKSDFLAVMSHELRTPLAGVIGVLDLLRN----------NPPAHLL- 479

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
rey+ +++++ae+llr+++d+Ld ++ieag
CP001032_2 480 ----------REYTAVARDSAESLLRILDDILDTAKIEAG 509

CP001032_0772: domain 1 of 2, from 360 to 429: score 79.3, E = 4.5e-22
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ak +f++n+sHE+RTPLt I+g +e Ll + +++l+++
CP001032_0 360 AKIDFFSNVSHEFRTPLTLILGPLEELLS-----EPARSALPADA-- 399

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
re l++++r + rll+L+n lLd+sr+eag
CP001032_0 400 ----------REQLKVVHRNSLRLLKLVNMLLDFSRLEAG 429

CP001032_1636: domain 1 of 1, from 373 to 441: score 77.8, E = 1.2e-21
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ak+ ++ ++sHEL+TPLt++r+++ lLle++ ++l+++q
CP001032_1 373 AKTNLVGTVSHELKTPLTGLRMAVYLLLEQQI------GTLTAPQ-- 411

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
re+le ++++a+rllr++++lLdl+r+eag
CP001032_1 412 ----------RELLEGARDDADRLLRILDNLLDLARLEAG 441

CP001032_1132: domain 1 of 1, from 1228 to 1296: score 74.3, E = 1.1e-20
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
kseflan+sHELRTPL++I+ + + L e++ ++l+ +q+
CP001032_1 1228 YKSEFLANMSHELRTPLNSILILGQQLAENAT------GNLTTKQI- 1267

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ + i++++ ll+Li d+Ldls+ie+g
CP001032_1 1268 -----------DFARNIHSSGTDLLNLITDILDLSKIESG 1296

CP001032_0364: domain 1 of 1, from 559 to 624: score 73.7, E = 1.7e-20
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aksef+a++sHE+RTPL+aI+g++++ e +++s+ ++
CP001032_0 559 AKSEFIAMASHEIRTPLNAILGLTDA--E---------PPASDAAVA 594

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
re le i+ ++erll +ndlLdlsr+eag
CP001032_0 595 ----------RERLELIRGAGERLLGVVNDLLDLSRAEAG 624

CP001032_3060: domain 1 of 1, from 318 to 384: score 72.1, E = 4.9e-20
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ak+efla+lsHELRTPLt +++++++L+ + ++e
CP001032_3 318 AKDEFLAALSHELRTPLTPVLMMTQMLEQ--------ERSFPPEV-- 354

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r+ l+ti+r +e rLi+dlLdl+ri g
CP001032_3 355 ----------RDDLRTIRRNVELEMRLIDDLLDLTRITRG 384

CP001032_1831: domain 1 of 1, from 251 to 317: score 71.2, E = 8.8e-20
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++ +f+a++sHELRTP+++ +++++ +l e+++e+
CP001032_1 251 RQVQFTADASHELRTPVSVTLLTSQSALS---------RERTPEE-- 286

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
yre+l t +r+a+r+++L++ lL l+r++a
CP001032_1 287 ---------YREALATCERAAQRMRQLVESLLLLARLDAR 317

CP001032_0037: domain 1 of 1, from 810 to 878: score 70.1, E = 1.8e-19
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++ f+ ++sH+LRTPL +rg+ae++++++ ++ls+e
CP001032_0 810 ELEAFTYSVSHDLRTPLQFVRGFAEAIRTDAG------ATLSAEN-- 848

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r+yl++i+r+a r++ +i+dlL +sr+
CP001032_0 849 ----------RDYLQRIIRAATRMDTIIQDLLSYSRLART 878

CP001032_3560: domain 1 of 1, from 353 to 419: score 67.0, E = 1.3e-18
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ak+ fla+lsHELRTPLt ++++a +L+ +++ ++++
CP001032_3 353 AKDHFLAMLSHELRTPLTPVLAAAGVLEH---------DDRLPQDV- 389

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
re l+ i+r + +rL++dlLdl+++e g
CP001032_3 390 ----------REDLRMIRRNIGIQSRLVDDLLDLTKLERG 419

CP001032_0818: domain 1 of 1, from 192 to 257: score 64.7, E = 6.1e-18
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
k+eflan+ HEL TPL++I+g + l+ e ++l+++q
CP001032_0 192 VKNEFLANITHELLTPLHGIMGSLALMSE---------DALNADQ-- 227

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ l ++ +ae+l+rL++++ + ++eag
CP001032_0 228 ----------ASSLADVRTCAESLNRLLQQIVAFNQAEAG 257

CP001032_0775: domain 1 of 1, from 374 to 440: score 62.6, E = 2.3e-17
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ak++fla+lsHELRTPL+ ++++a+ + e d++l++
CP001032_0 374 AKDDFLATLSHELRTPLNPVLLLASEAAE--------DPTLPPAV-- 410

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r + ti++ +e rLi+dlLdl+ri g
CP001032_0 411 ----------RSDFATIRNNVELEARLIDDLLDLTRITRG 440

CP001032_1608: domain 1 of 1, from 360 to 426: score 60.3, E = 1.1e-16
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ +f a++sH+L+TP+t++r+ +e Ll+ +++l++e+
CP001032_1 360 RAARFSADASHQLKTPVTVLRAGLEELLA--------RENLTAEE-- 396

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++t+++++ rl+ i+dlL lsr++ag
CP001032_1 397 ----------CHEISTLIHQTYRLSGVIEDLLLLSRMDAG 426

CP001032_0261: domain 1 of 1, from 259 to 326: score 58.3, E = 4e-16
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+k+ef+a ++H+LR PL+++rg+aelL++ + l+ee+++
CP001032_0 259 EKNEFMAIAAHDLRAPLATVRGFAELLRD---------GRLGEEEKR 296

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+++ i+ +a r+l L+ d L +e+g
CP001032_0 297 ----------VTAVHEIHAQATRMLGLVTDYLGAHAAESG 326

CP001032_2922: domain 1 of 1, from 434 to 500: score 57.7, E = 6.1e-16
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aks+fla+lsHELRTPL+ +++++ ++ +el++e
CP001032_2 434 AKSDFLATLSHELRTPLAPVMLTLPYVET--------HPELPAEL-- 470

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r +e+i+r +e rLi+dlLdl+r e g
CP001032_2 471 ----------RSHVESIRRNVELEIRLISDLLDLTRVERG 500

CP001032_1401: domain 1 of 1, from 229 to 295: score 56.9, E = 1e-15
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ +f+a++sHEL+TPL+ +r++ae L+ + ++++e
CP001032_1 229 QVKRFTADASHELKTPLALLRLNAEKLRG--------RLAADAEA-- 265

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+++ +l++++ l+r i+ lL l+++e+g
CP001032_1 266 ----------SAAVDEMLEDLDALRRVIDTLLFLAKAESG 295

CP001032_0942: domain 1 of 1, from 427 to 495: score 56.7, E = 1.1e-15
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++ f ++sH+LR PL I g+a+lL + + ++l+e+
CP001032_0 427 ELEAFSYSVSHDLRAPLRHIDGFASLLAK------HAAGTLDEKG-- 465

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++++ +i ++a+r+ rLi+dlL++sr++
CP001032_0 466 ----------QRFITIISDAARRMGRLIDDLLTFSRMGRA 495

CP001032_1099: domain 1 of 1, from 159 to 225: score 54.6, E = 4.3e-15
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
k++fla+lsHELRTPLt ++++a + + ++l++
CP001032_1 159 TKDQFLAALSHELRTPLTPVLLLATEAAA--------QPALDARA-- 195

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r+ +e i r + rLi+dlLdl+ri g
CP001032_1 196 ----------RQDFEMIARNVALEARLIDDLLDLTRISRG 225

CP001032_1228: domain 1 of 1, from 196 to 262: score 54.5, E = 4.8e-15
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ak+ f+a+lsHELRTPLt ++ +a L+e d+ +++
CP001032_1 196 AKDGFFAALSHELRTPLTPVLITAASLRE--------DPRFPADV-- 232

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
re l i+r + rLi+dlLd +ri +g
CP001032_1 233 ----------REELAMIERNIALEARLIDDLLDVTRIAHG 262

CP001032_2930: domain 1 of 1, from 320 to 386: score 53.7, E = 7.9e-15
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ak+efla+lsHELRTPL+ ++++a+ ++ + ++
CP001032_2 320 AKDEFLAALSHELRTPLNPVLLLASESALNA--------DYPATA-- 356

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
re+++ i++ a rLi+dlLdl+rie g
CP001032_2 357 ----------REAFRMIEKNALLEARLIDDLLDLTRIERG 386

CP001032_1131: domain 1 of 1, from 336 to 402: score 53.4, E = 9.6e-15
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ak++fla lsHELRTPL+ ++++a+ + d++l++e
CP001032_1 336 AKDDFLARLSHELRTPLNPVLLLASEAAG--------DPTLPPEV-- 372

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r +e+i + + rLi+dlLdl+ i g
CP001032_1 373 ----------RADFESIAQNVTLEARLIDDLLDLTAITRG 402

CP001032_3727: domain 1 of 1, from 251 to 319: score 52.4, E = 1.9e-14
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++ f ++sH+LR PL I g+a++L + + + l+e+
CP001032_3 251 ELESFSYSVSHDLRAPLRHIDGFASMLTA------HAAESLDEQS-- 289

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r+yl +i ++a+r+ rLi+dlL +sr +
CP001032_3 290 ----------RRYLTVITDAAKRMGRLIDDLLSFSRNGRA 319

CP001032_1309: domain 1 of 1, from 255 to 320: score 52.3, E = 1.9e-14
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++ + +l+H + PL+aIrg+aelL e ++++eqr
CP001032_1 255 HAERYTQALAHGVKAPLAAIRGAAELLHE----------DMPAEQR- 290

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r++ i e+ r++++i++lL+ls +ea
CP001032_1 291 ----------RKFMGNIAVESARIQQIIDRLLELSSLEAR 320

CP001032_1803: domain 1 of 1, from 704 to 770: score 52.3, E = 2e-14
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ak++fla+lsHELRTPL+ +++ a+ + e+ ++l +e
CP001032_1 704 AKDDFLAALSHELRTPLNPVLLIASDAAEN--------PALAAEV-- 740

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r+ + ti++ +e rLi+dlLd +ri +g
CP001032_1 741 ----------RRDFATIRKNVELEARLIDDLLDVTRITHG 770

CP001032_3545: domain 1 of 1, from 343 to 408: score 51.3, E = 3.9e-14
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a + ++ +++H+L++ L+ ++++a lL+e +e +
CP001032_3 343 AIGTLAGGVAHDLNNILAPMLMAAGLLKE---------NITNEHD-- 378

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
re+l+ ++r+a+r ++i++lL++sr +g
CP001032_3 379 ----------REMLSMVERSARRGADIIRQLLTFSRGVEG 408

CP001032_0772: domain 2 of 2, from 1178 to 1244: score 50.9, E = 4.8e-14
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ak++fla+lsHELRTPL+ ++++a+ + + d+ l++
CP001032_0 1178 AKDDFLAALSHELRTPLSPVLLLASDAAA--------DPQLPPSV-- 1214

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r +eti++++e rLi+dlLdl+ri
CP001032_0 1215 ----------RADFETIRKSVELEARLIDDLLDLTRIVRD 1244

CP001032_1720: domain 1 of 1, from 275 to 341: score 50.7, E = 5.6e-14
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a++e l n++H+LRTPLt +rg+ael+l + + +
CP001032_1 275 AMREALDNVAHDLRTPLTRLRGTAELALQ---------NAENRGPQ- 311

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+e+l ++a+ lrL++ l+++s +eag
CP001032_1 312 ----------AEALADCVEQADDVLRLLRALMEISEAEAG 341

CP001032_0461: domain 1 of 1, from 268 to 334: score 50.1, E = 8.6e-14
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++ ++ +++H++++ L+ I gy+e +l +++ + +
CP001032_0 268 SLGTLAGGIAHDFNNLLAIIHGYSEFCLQ---------GAAEPAVM- 304

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ l+ i+r+a+r + L+ ++L++sr +
CP001032_0 305 ----------QKSLQEIHRAAQRASGLVKQILTFSRKAEI 334

CP001032_1995: domain 1 of 1, from 351 to 417: score 49.8, E = 1e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++ ++a ++HE+R+PLt+I+++ L + +++ r
CP001032_1 351 TLGLLAAEIAHEIRNPLTVIKLLHGGLGL---------DFPPDDPR- 387

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r +++i + +++l+++++++L ++++ a
CP001032_1 388 ----------RTDVRVINEKLDQLESIVSRVLNFAKAPAA 417

CP001032_4116: domain 1 of 1, from 339 to 405: score 49.5, E = 1.3e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a +e++a+++H++++ Lt+I+g++++ +e + e+ +++
CP001032_4 339 AIGELAAGIAHDFNNMLTVIQGNTSIVRE--------RLERHSPH-- 375

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+e+let+ ++aer +L+n+lL++sr +
CP001032_4 376 ----------HELLETVASAAERSAKLVNQLLTFSRKQVL 405

CP001032_4051: domain 1 of 1, from 1 to 60: score 49.4, E = 1.4e-13
*->lsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrlpeLRledp
+sHELRTPL+aI++ + l++e ++l e ++l
CP001032_4 1 MSHELRTPLSAILLWTTLIEE---------EKLEEREQL-------- 30

eyreyletilreaerllrLindlLdlsrieag<-*
+e+l i+++ae l++Li++l + +ri +g
CP001032_4 31 --QEALAAIKHSAEELQALIDNLVETTRIVSG 60

CP001032_0315: domain 1 of 1, from 255 to 313: score 48.6, E = 2.2e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a++++l ++sHELR PLt +r ++elL e
CP001032_0 255 AREQLLLDVSHELRSPLTRLRVALELLPE------------------ 283

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ + +++ ++r+i +lL+l+r+++g
CP001032_0 284 ----------NKQRAGMAADVREMERMIAELLELERLRSG 313

CP001032_1328: domain 1 of 1, from 910 to 976: score 48.6, E = 2.2e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a ++++ +++H++++ Lt+I+g elL e +els+ +r
CP001032_1 910 AIGQLAGGIAHDFNNLLTVILGQGELLTE---------PELSATER- 946

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+++ i+++a+r ++L ++lL +sr +a
CP001032_1 947 ----------DTAVRDIKSAAQRASNLTRQLLVFSRHQAM 976

CP001032_0365: domain 1 of 1, from 276 to 343: score 48.4, E = 2.6e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ ++ +sH+LR PLt+++gy+++L e++ +l++e
CP001032_0 276 LLMSYASFVSHDLRSPLTVVKGYLSMLVEGV-------VPLPPEA-- 313

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++++ +++++ +++L++++L+l++ ++
CP001032_0 314 ----------AQLVTPAYNATLVMQDLVQNILQLAKDAHE 343

CP001032_3287: domain 1 of 1, from 380 to 446: score 46.0, E = 1.2e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ak++fla+lsHELRTPLt ++ a + ++l + +
CP001032_3 380 AKDRFLAMLSHELRTPLTPALMIAAEFEC---------SPLVPAAL- 416

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ l +++ ++e rLi+dlLd sr g
CP001032_3 417 ----------HDDLAVVRASIELEARLIDDLLDVSRVTRG 446

CP001032_0723: domain 1 of 1, from 331 to 395: score 43.7, E = 5.3e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+k+e+l +++H+LR PLt+I++ ++ l+ +++ +
CP001032_0 331 EKTELLQMAAHDLRGPLTGIQLVMDASLR-----------MNAVPQ- 365

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
e+l+ ++++++r+ L+ +lLd +e+g
CP001032_0 366 ----------GEALRMVDEQVHRMTTLLGNLLDADALEHG 395

CP001032_2841: domain 1 of 1, from 960 to 1026: score 43.3, E = 7.2e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ + ++ +++H++++ LtaI+gy+el+ ++ + + +
CP001032_2 960 SIGTLAGGIAHDFNNILTAILGYCELASQ---------DAPDNPAL- 996

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ l i++++ r +L+ ++L++sr +
CP001032_2 997 ----------QGDLAGIRSAGTRAKELVARILTFSRQTHV 1026

CP001032_3023: domain 1 of 1, from 410 to 476: score 42.9, E = 9.3e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ak++fla+lsHELRTPLt ++ a L+ ++l + ++
CP001032_3 410 AKDRFLATLSHELRTPLTPALMVAADLEH---------SPLIPLEL- 446

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r+ ti+ +e rLi+dlLd +ri +g
CP001032_3 447 ----------RQDCATIRTNIELEARLIDDLLDVARIAQG 476

CP001032_1522: domain 1 of 1, from 448 to 514: score 40.6, E = 4.2e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a + ++ +++H++++ L +I+gy+ ++le + + +r
CP001032_1 448 AVGMLAGGVAHDFNNLLQVIQGYTGIALE---------ASTTIAER- 484

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r le +++++er +L ++lL + r ++
CP001032_1 485 ----------RASLEQVRHASERATQLTRQLLAFGRRQNL 514

CP001032_3059: domain 1 of 1, from 842 to 907: score 40.4, E = 4.8e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++ ++++++H+L++ Lt I++ +elL+ +++ +
CP001032_3 842 SLGALASGVAHDLNNVLTPILMSVELLRP---------LAQNQAD-- 877

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r++l+ + ++a+r ++++++lL + r +
CP001032_3 878 ----------RDMLQLLSDSARRGSDIVQQLLLFGRGSES 907

CP001032_1270: domain 1 of 1, from 24 to 90: score 40.1, E = 5.7e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+s++l+ l+HE R+PL+++ +++lL+e+l + l+ +++
CP001032_1 24 LLSRLLSRLAHEVRNPLSSLDVHVQLLEEDL-------HQLPGGTLP 63

peLRledpeyreyletilreaerllrLindlLdls<-*
++ +e le+i+ e++rl++++ ++L l+
CP001032_1 64 KA--------AERLEIIRTELKRLDNIVLQFLSLA 90

CP001032_1739: domain 1 of 1, from 1087 to 1153: score 39.4, E = 8.9e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++ ++ +++H++++ Lt+I+g+++l++ d++ +++
CP001032_1 1087 SLGVLAGGIAHDFNNLLTVIMGNLSLAKI--------DPKIEPDT-- 1123

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ l+ +r+a r ++L ++lL++++ +++
CP001032_1 1124 ----------VRCLSESERAAARARDLTQQLLTFAKGGEP 1153

CP001032_0805: domain 1 of 1, from 135 to 201: score 39.4, E = 8.9e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
k++f++ + H+LR+P+ I++++el+++ ++ +e +
CP001032_0 135 IKEQFMRIAGHDLRNPVCLILMAVELARR---------SAGKPELL- 171

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
e l +i +++ +++r+i+ +L + ag
CP001032_0 172 ----------GEHLTSIADSVAQIRRIIDTFLGIKMPLAG 201

CP001032_0963: domain 1 of 1, from 793 to 859: score 39.3, E = 9.4e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++ ++ +++H++++ Lt I+g++ l+l+ d++lse ++
CP001032_0 793 SLGVLAGGIAHDFNNLLTIIIGNLGLALA--------DGKLSESTI- 830

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++l+ i+r a r ++L ++lL+++ +++
CP001032_0 831 -----------RFLREIERGATRARSLTRQLLTFAEGGEP 859

CP001032_0929: domain 1 of 1, from 386 to 451: score 39.2, E = 1e-10
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ + ++ +++H++++ L I++ +elL+ + s+e+
CP001032_0 386 SIGLLAGGVAHDINNVLLPIMASTELLEP---------MATSPET-- 421

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+++l +i+++a++ +L+++lL ++r g
CP001032_0 422 ----------KQFLASIRSSAQHGAALVRQLLAFARGAVG 451

CP001032_1475: domain 1 of 1, from 240 to 306: score 38.5, E = 1.6e-10
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
k+++la ++H+LR PL++I++ a++L+ el++ l
CP001032_1 240 FKTDLLARAAHDLRDPLNSISLRAQTLRS----------ELPAASGL 276

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ +++ i+++a++l + + +lL+ e+
CP001032_1 277 ----------QPLVNGIDDSARQLAEFVGNLLTDVAVETR 306

CP001032_0384: domain 1 of 1, from 967 to 1033: score 38.5, E = 1.6e-10
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++ ++ +++H++++ Lt+I+gy el + ++e
CP001032_0 967 TLGTLAGGIAHDFNNLLTGIMGYQELVSD--------VLGENSEA-- 1003

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r+yl ++ ++ r ++L++++L++ r +
CP001032_0 1004 ----------RDYLAQARGASVRARELVEQILTFGRQSSD 1033

CP001032_1838: domain 1 of 1, from 417 to 483: score 38.5, E = 1.6e-10
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a + ++ +++H++++ L +Irg+a L+e + + +
CP001032_1 417 AIGLLAGGVAHDFNNILQVIRGHAGFLEE--------SLAGAAAP-- 453

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
e ++til+++er +L ++lL +sr +
CP001032_1 454 ----------LEDVRTILSASERGAQLTRQLLAFSRKQPL 483

CP001032_0771: domain 1 of 1, from 137 to 204: score 38.3, E = 1.8e-10
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
f + ++H+LRTPL ++++++e+L e + e +++
CP001032_0 137 DVATFGSRIAHDLRTPLGGVMTTTEMLHE-------ILMESDPDN-- 174

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ +++ il++a+ l +Li+++ l+++ a
CP001032_0 175 ----------AALTQPILDSADGLVKLIERMSFLAKAIAS 204

CP001032_2461: domain 1 of 1, from 1305 to 1371: score 38.1, E = 2.1e-10
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ + ++ +++H++++ Lta++g++ l+ + +e ++
CP001032_2 1305 SVGILAGGIAHDFNNILTAVMGNVALAGL---------DVDPESEA- 1341

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ l+ +++++ r ++L ++lL++++ +++
CP001032_2 1342 ----------ARSLREAEKATLRARDLTQQLLTFAKGGEP 1371

CP001032_2090: domain 1 of 1, from 164 to 238: score 36.9, E = 4.7e-10
*->akseflanlsHELRTPLtaIrgyaelLleeldkv.lagdtelseeqr
+ ++a+++HEL +PL+++ +++l++++l k ++a+d + + +
CP001032_2 164 SILLLAAGVAHELGNPLNSLTIHLQLMERRLKKArTAKDKDVAALE- 209

lpeLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ + + + e++rl+ +i ++L+ r + +
CP001032_2 210 ------------DSVAICRAEVRRLDGIITNFLEAVRPRVP 238

CP001032_2397: domain 1 of 1, from 443 to 509: score 36.5, E = 6e-10
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ + a+l+HE+R+PL +I+++++lL + + + r
CP001032_2 443 TVGLMGAGLAHEIRNPLVTIKTFVQLLPK---------HYDDRAFR- 479

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++++ i +e+ r+++L ++lLdl+ +a
CP001032_2 480 ----------EKFTGLIGDEVTRIDHLTEQLLDLASPRAY 509

CP001032_0941: domain 1 of 1, from 551 to 616: score 34.7, E = 1.9e-09
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ + ++a+++H+L++ L+ I+++a +L++ ++ ++ ++
CP001032_0 551 SIGMLAAGIAHDLNNVLAPILLAAPMLRD---------HATDPGDI- 587

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+++ t++++aer +L++++L ++ g
CP001032_0 588 -----------RMIATLEKSAERGAALVRQILGFAHGADG 616

CP001032_1123: domain 1 of 1, from 613 to 678: score 34.6, E = 2.1e-09
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++ ++a++sH+L++ L+ +r+ lL++ lse+
CP001032_1 613 NLGMLAAGISHDLNNILAPMRMVGPLLRD----------RLSEPRD- 648

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++l+t++++a r L++++L +++ ag
CP001032_1 649 ----------LRLLDTLESCAARGAGLVRQILGFAQGVAG 678

CP001032_0845: domain 1 of 1, from 152 to 218: score 32.8, E = 6.9e-09
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a ++++ +++H++++ L++I gy+e+L + + + +q+
CP001032_0 152 AVGRLAGGVAHDFNNLLSVINGYCEMLAA---------QVSDRPQA- 188

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ ++ i+r++ r L ++lL + r +
CP001032_0 189 ----------LREVSEIHRAGLRAAGLTRQLLAFGRRQPM 218

CP001032_1182: domain 1 of 1, from 469 to 525: score 31.5, E = 1.6e-08
*->HELRTPLtaIrgyaelLleeldkvlagdtelseeqrlpeLRledpey
HELR+P+++++ +++lL e + +
CP001032_1 469 HELRNPMATLKSFSQLLPE---------KIDDKTFL----------- 495

reyletilreaerllrLindlLdlsrieag<-*
+++ e++ +eaer ++L ++lLdlsr ++
CP001032_1 496 ADFAEIVPKEAERVESLAQQLLDLSRPRTY 525

CP001032_4450: domain 1 of 1, from 469 to 525: score 31.1, E = 2e-08
*->HELRTPLtaIrgyaelLleeldkvlagdtelseeqrlpeLRledpey
HELR+P+++++ +++lL e + +
CP001032_4 469 HELRNPMATLKSFSQLLPE---------KIDDKTFL----------- 495

reyletilreaerllrLindlLdlsrieag<-*
++ e++ +eaer ++L ++lLdlsr ++
CP001032_4 496 GDFAEIVPKEAERVESLAQQLLDLSRPRTY 525

CP001032_4010: domain 1 of 1, from 477 to 538: score 30.5, E = 3.1e-08
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++ ++ +++H++++ Lt+I+g+a l++ +++se ++
CP001032_4 477 SLGLLAGGIAHDFNNILTGILGHANLARC---------APASETEL- 513

peLRledpeyreyletilreaerllrLindlLdls<-*
e l+ i+ a r +L +++L +s
CP001032_4 514 ----------VEHLRQIEAGAARAAELCQQMLAFS 538

CP001032_1905: domain 1 of 1, from 436 to 502: score 30.0, E = 4.1e-08
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a +e++ +++HE+++ Lt +++ + ++++ + +++ +
CP001032_1 436 AIGELVGGIAHEFNNLLTPMLLQTTMIRD---------GIAPAGPV- 472

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ l+ ++ ++ ++L +++L++ r +
CP001032_1 473 ----------GDQLKPVIAAITEARDLTQRILTFGRRASV 502

CP001032_0955: domain 1 of 1, from 143 to 211: score 28.2, E = 1.4e-07
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
k+e+l l+H+L++ L ++++ ++lL e++ ++
CP001032_0 143 DKDELLGILAHDLKNHLGGMLMSVQLLNEKA-------KSINDSR-- 180

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++++ ilr+++++l+ + ++L s ++g
CP001032_0 181 ---------FQRMGANILRATDQMLSFVKEFLANSEVDHG 211

CP001032_0172: domain 1 of 1, from 452 to 518: score 27.5, E = 2.1e-07
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
k+efl ++ ELR PL + ++ + +L ++ +e++
CP001032_0 452 LKEEFLNAVVQELRVPLESTLLQIRALAG---------QAGVPEHL- 488

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r le i r + +rL+ndlLdl+ri g
CP001032_0 489 ----------RFELEAIARNLTTESRLVNDLLDLTRIARG 518

CP001032_2151: domain 1 of 1, from 144 to 210: score 27.2, E = 2.6e-07
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ + ++a+++H++++ L+ +++++e+L+ +++ s+ q
CP001032_2 144 STGILAAGIAHDFNNLLSRLLLNLEALRY--------SGPISPAQ-- 180

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ l ++++++ +L ++l ++ +a+
CP001032_2 181 ----------ASQLGEARQAIQAAGALTRQLIAFAEGGAP 210


Histogram of all scores:
score obs exp (one = represents 15 sequences)
----- --- ---
-15 1 0|=
-14 7 0|=
-13 48 3|*===
-12 156 105|======*====
-11 421 546|============================= *
-10 698 1014|=============================================== *
-9 846 1047|========================================================= *
-8 819 784|====================================================*==
-7 611 494|================================*========
-6 374 284|==================*======
-5 241 156|==========*======
-4 139 83|=====*====
-3 74 44|==*==
-2 34 23|=*=
-1 27 12|*=
0 9 6|*
1 8 3|*
2 2 1|*
3 4 0|=
4 4 0|=
5 0 0|
6 0 0|
> 7 89 -|======


% Statistical details of theoretical EVD fit:
mu = -8.9758
lambda = 0.6525
chi-sq statistic = 375.9092
P(chi-square) = 0

Total sequences searched: 4612

Whole sequence top hits:
tophits_s report:
Total hits: 77
Satisfying E cutoff: 77
Total memory: 23K

Domain top hits:
tophits_s report:
Total hits: 78
Satisfying E cutoff: 78
Total memory: 52K


Acknowledgements:

This research is funded by:

Developed by: