Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
25 projects found  

1 accessions found for Opitutus terrae PB90-1  

Data for CP001032  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001032.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001032_1675 CDS_2069104-2067947 95.6 7.6e-28 1
CP001032_2916 CDS_3745740-3743587 80.3 2.5e-23 1
CP001032_1278 CDS_1594975-1592747 73.2 3.1e-21 1
CP001032_3636 CDS_4740379-4741416 58.9 5.2e-17 1
CP001032_0824 CDS_1010089-1012023 53.1 2.5e-15 1
CP001032_0043 CDS_56483-54801 49.4 3.4e-14 1
CP001032_3358 CDS_4419880-4416734 45.7 4e-13 1
CP001032_3218 CDS_4219414-4222515 43.5 1.8e-12 1
CP001032_1693 CDS_2092241-2090676 42.0 4.9e-12 1
CP001032_1542 CDS_1921726-1922778 39.9 2e-11 2
CP001032_2487 CDS_3218666-3215571 39.2 3.2e-11 1
CP001032_1231 CDS_1532265-1533398 37.0 1.5e-10 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001032_1675 1/1 189 257 .. 1 70 [] 95.6 7.6e-28
CP001032_2916 1/1 519 586 .. 1 70 [] 80.3 2.5e-23
CP001032_1278 1/1 524 591 .. 1 70 [] 73.2 3.1e-21
CP001032_3636 1/1 145 212 .. 1 70 [] 58.9 5.2e-17
CP001032_0824 1/1 435 500 .. 1 70 [] 53.1 2.5e-15
CP001032_0043 1/1 359 426 .. 1 70 [] 49.4 3.4e-14
CP001032_3358 1/1 836 902 .. 1 70 [] 45.7 4e-13
CP001032_3218 1/1 827 893 .. 1 70 [] 43.5 1.8e-12
CP001032_1693 1/1 323 382 .. 1 70 [] 42.0 4.9e-12
CP001032_1542 2/2 154 221 .. 1 70 [] 39.8 2.2e-11
CP001032_2487 1/1 828 894 .. 1 70 [] 39.2 3.2e-11
CP001032_1231 1/1 171 238 .. 1 70 [] 37.0 1.5e-10

Alignments of top-scoring domains:
CP001032_1675: domain 1 of 1, from 189 to 257: score 95.6, E = 7.6e-28
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD++g+ L+ i++qle+ar+++ ++ p++a++ald++
CP001032_1 189 ERNRIAREIHDGIGHYLTTINVQLEAARAVF--TAQPAQAATALDQA 233

relarealaevRrllgdLR.paal<-*
++l+real++vRr +g+LR +++
CP001032_1 234 ARLSREALEDVRRSVGTLRaDSTR 257

CP001032_2916: domain 1 of 1, from 519 to 586: score 80.3, E = 2.5e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R ARE+HD+++Q+L ai++qlelar+++ + +++r++l +
CP001032_2 519 ERNRVAREIHDTLSQGLGAISVQLELARTHA--GEMSAPVRDHLGLA 563

relarealaevRrllgdLRpaal<-*
++lar ala++R+ ++++R ++l
CP001032_2 564 HKLARAALADARDSIWNMRSQVL 586

CP001032_1278: domain 1 of 1, from 524 to 591: score 73.2, E = 3.1e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+AR+LHD++ Q+L++i+lql++a++l+ +d e+ + +l+ +
CP001032_1 524 ERTRLARDLHDTLEQTLTGIALQLDTAAKLF--GRDGEQSQHHLQLA 568

relarealaevRrllgdLRpaal<-*
r +++++ ++Rr ++dLR +l
CP001032_1 569 RNWLHQSQVDLRRSIWDLRSREL 591

CP001032_3636: domain 1 of 1, from 145 to 212: score 58.9, E = 5.2e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E R+ R+LHD++ QsL a+ l +e ar+l+ ++d+ +a+++l+++
CP001032_3 145 EKIRLGRDLHDGIIQSLYAAGLSIESARALA--RTDAVAADRQLAAC 189

relarealaevRrllgdLRpaal<-*
re ++++++evR+ + +L p l
CP001032_3 190 RENLNQTIREVRAYIAGLAPENL 212

CP001032_0824: domain 1 of 1, from 435 to 500: score 53.1, E = 2.5e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe..eareald
ER+ +ARELHD++gQ L+++k++l+ pe ++++ +l+
CP001032_0 435 ERRSLARELHDEIGQVLTVAKIHLQST------VLLPEcgRVAGRLK 475

eirelarealaevRrllgdLRpaal<-*
e +l+++ la+vR l +LRp+ l
CP001032_0 476 EPVALLDRLLAQVRSLSLNLRPPLL 500

CP001032_0043: domain 1 of 1, from 359 to 426: score 49.4, E = 3.4e-14
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RI +LHD++gQ+L++++ + ++r +l +k ++ +e +d i
CP001032_0 359 EQQRIGADLHDGLGQQLTGMACLAAALRDRL--KKTTPAEAENADLI 403

relarealaevRrllgdLRpaal<-*
++la+e+ a+ R+l+++L p +l
CP001032_0 404 ARLASESVAQSRALARGLCPVQL 426

CP001032_3358: domain 1 of 1, from 836 to 902: score 45.7, E = 4e-13
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+A E+HDs+ Q+Ls+++lql++ ++l + +r +l+ +
CP001032_3 836 ERNRLAGEIHDSLQQGLSGAILQLDATLKLRS-VTG--LVRSRLEVV 879

relarealaevRrllgdLRpaal<-*
r +++ + ev ++++dL + l
CP001032_3 880 RNMVSYTRHEVQHAVWDLESPLL 902

CP001032_3218: domain 1 of 1, from 827 to 893: score 43.5, E = 1.8e-12
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R+A E+HDsv Q+L++++lql++ + l ++ + r +l +
CP001032_3 827 ERDRLANEIHDSVQQGLTGAMLQLDTTL-KL--PAMSGDMRSRLNVV 870

relarealaevRrllgdLRpaal<-*
r ++ a +ev ++++d+ + l
CP001032_3 871 RNMVAYARQEVQHAVWDMESPLL 893

CP001032_1693: domain 1 of 1, from 323 to 382: score 42.0, E = 4.9e-12
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ IARELHD vgQ L++++ le+ r + al+e+
CP001032_1 323 ERRSIARELHDQVGQLLTGLRFRLEATR----------RDPSALTEA 359

relarealaevRrllgdLRpaal<-*
+ +e ++ vR++ +LRp l
CP001032_1 360 LAVTDELIRTVREMTLQLRPRML 382

CP001032_1542: domain 2 of 2, from 154 to 221: score 39.8, E = 2.2e-11
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RI ++LHD++gQ+L+ai ++ +++ + + + +e+ +++++i
CP001032_1 154 EQHRIGQDLHDGLGQQLTAIEMMCASLKADV--AVAQPELTKQVERI 198

relarealaevRrllgdLRpaal<-*
+++rea + +R ++++L p +
CP001032_1 199 CAALREAVSHTRSMARGLVPVKD 221

CP001032_2487: domain 1 of 1, from 828 to 894: score 39.2, E = 3.2e-11
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+A E+HDs+ Q++++++lqle+ + ++ + +e++ l+ +
CP001032_2 828 ERNRLAGEIHDSLEQGFTGLTLQLETTA-AF--STCSPEVKSGLAVA 871

relarealaevRrllgdLRpaal<-*
++ + +evR++++d++ ++l
CP001032_2 872 LNMVAFSRNEVRHAVRDMHSPIL 894

CP001032_1231: domain 1 of 1, from 171 to 238: score 37.0, E = 1.5e-10
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ I+RELH +v Q+L +i++ql ++ +++ +++ +d
CP001032_1 171 ERREISRELHGEVVQTLVGINVQLATLGKAA--SLGIRGLKAKIDLT 215

relarealaevRrllgdLRpaal<-*
++l+ ++ + v + +++LRpa+l
CP001032_1 216 QRLVARSVNAVHQFARELRPAVL 238


Histogram of all scores:
score obs exp (one = represents 13 sequences)
----- --- ---
-14 4 0|=
-13 30 0|===
-12 76 51|===*==
-11 158 422|============= *
-10 450 980|=================================== *
-9 728 1113|======================================================== *
-8 679 858|===================================================== *
-7 657 539|=========================================*=========
-6 543 305|=======================*==================
-5 559 163|============*==============================
-4 259 85|======*=============
-3 172 43|===*==========
-2 107 22|=*=======
-1 74 11|*=====
0 36 5|*==
1 32 2|*==
2 12 1|*
3 9 0|=
4 8 0|=
5 3 0|=
6 1 0|=
> 7 15 -|==


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 3340.4709
P(chi-square) = 0

Total sequences searched: 4612

Whole sequence top hits:
tophits_s report:
Total hits: 12
Satisfying E cutoff: 12
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 12
Satisfying E cutoff: 12
Total memory: 25K


Acknowledgements:

This research is funded by:

Developed by: