Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
39 projects found  

6 accessions found for Nostoc punctiforme PCC 73102  

Data for CP001037  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP001037.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001037_3264 CDS_4630415-4631452 170.4 3e-48 1
CP001037_5488 CDS_7409358-7411313 151.5 9.8e-43 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001037_3264 1/1 150 236 .. 1 94 [] 170.4 3e-48
CP001037_5488 1/1 454 542 .. 1 94 [] 151.5 9.8e-43

Alignments of top-scoring domains:
CP001037_3264: domain 1 of 1, from 150 to 236: score 170.4, E = 3e-48
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQ+ISSLL+LQa++ kd v le++++sqnR+ +
CP001037_3 150 EIHHRVKNNLQIISSLLNLQAEYLKDNQV-----LEVFKDSQNRIET 191

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAliHE+LY+s dl +++f+eY++ L+ nLf sy+v ++ i Lk +
CP001037_3 192 MALIHEKLYQSQDLAKINFAEYIQDLVTNLFYSYNVNASAITLK--M 236

CP001037_5488: domain 1 of 1, from 454 to 542: score 151.5, E = 9.8e-43
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHRVKNNLQ++SSLL LQ++ kd+e+ +++LrEsqnR+ S
CP001037_5 454 EVHHRVKNNLQIVSSLLQLQSQTLKDPEA-----IKVLRESQNRIES 495

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
++liH+ LY+s +++++d+ +Y+++L+++L+ sy+ ++i L+ D+
CP001037_5 496 ISLIHKNLYTSANIGQIDVVDYISNLAASLLISYQIWPERITLETDI 542


Histogram of all scores:
score obs exp (one = represents 25 sequences)
----- --- ---
-15 5 0|=
-14 17 0|=
-13 73 38|=*=
-12 297 399|============ *
-11 1426 1113|============================================*=============
-10 1180 1440|================================================ *
-9 1068 1216|=========================================== *
-8 811 816|================================*
-7 430 484|================== *
-6 409 270|==========*======
-5 160 145|=====*=
-4 106 77|===*=
-3 48 40|=*
-2 27 21|*=
-1 16 10|*
0 8 5|*
1 0 2|*
2 1 1|*
> 3 5 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 307.9440
P(chi-square) = 0

Total sequences searched: 6087

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: