Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
39 projects found  

6 accessions found for Nostoc punctiforme PCC 73102  

Data for CP001037  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001037.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001037_2179 CDS_2995786-2994521 97.2 3.6e-28 1
CP001037_1658 CDS_2216172-2217287 89.8 5.4e-26 1
CP001037_2170 CDS_2983339-2980553 73.5 3.4e-21 1
CP001037_1634 CDS_2185407-2186666 59.0 6.4e-17 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001037_2179 1/1 223 290 .. 1 70 [] 97.2 3.6e-28
CP001037_1658 1/1 171 238 .. 1 70 [] 89.8 5.4e-26
CP001037_2170 1/1 730 797 .. 1 70 [] 73.5 3.4e-21
CP001037_1634 1/1 219 286 .. 1 70 [] 59.0 6.4e-17

Alignments of top-scoring domains:
CP001037_2179: domain 1 of 1, from 223 to 290: score 97.2, E = 3.6e-28
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HDs+g+sL+a++lqle+a++l +++p++a++ l+++
CP001037_2 223 ERNRIAREIHDSLGHSLTALNLQLETALKLW--QSNPGKAETFLATA 267

relarealaevRrllgdLRpaal<-*
+el+++al++vR+ ++++R l
CP001037_2 268 KELGSKALNDVRQSVSTMRSNPL 290

CP001037_1658: domain 1 of 1, from 171 to 238: score 89.8, E = 5.4e-26
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIAR++HDs+g+sL a+++q+e+a++l ++d +ar l ++
CP001037_1 171 ERNRIARDIHDSLGHSLVALNVQMETALTLW--ETDLNRARSFLLAA 215

relarealaevRrllgdLRpaal<-*
++l++eal+evR+ ++++R + l
CP001037_1 216 KKLGSEALQEVRESVSAIRSDPL 238

CP001037_2170: domain 1 of 1, from 730 to 797: score 73.5, E = 3.4e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+A+E+HD+++Q++++++++l++a r l ++d e a++ +++
CP001037_2 730 ERNRLAQEIHDTLAQAFTVVIVHLDTASRKL--TTDIEVAQKLIKAG 774

relarealaevRrllgdLRpaal<-*
r+la+ +l+e+Rr + +LR + l
CP001037_2 775 RDLAHSGLTEARRSIKALRSQLL 797

CP001037_1634: domain 1 of 1, from 219 to 286: score 59.0, E = 6.4e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD++g++L a ++q+ + ++++++a + l+++
CP001037_1 219 ERNRIAREIHDGLGHTLVAQTIQINNTLLFW--ESNNDKALTFLKQA 263

relarealaevRrllgdLRpaal<-*
+el+ eal e+Rr l+ LR l
CP001037_1 264 KELGAEALLEIRRSLSLLRSNPL 286


Histogram of all scores:
score obs exp (one = represents 21 sequences)
----- --- ---
-14 24 0|==
-13 130 0|=======
-12 237 67|===*========
-11 390 557|=================== *
-10 1025 1294|================================================= *
-9 1181 1469|========================================================= *
-8 939 1132|============================================= *
-7 723 712|=================================*=
-6 524 403|===================*=====
-5 412 216|==========*=========
-4 209 112|=====*====
-3 133 58|==*====
-2 80 29|=*==
-1 25 15|*=
0 17 7|*
1 15 3|*
2 6 1|*
3 7 1|*
4 1 0|=
5 1 0|=
6 1 0|=
7 1 0|=
8 0 0|
9 1 0|=
> 10 5 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1112.3680
P(chi-square) = 0

Total sequences searched: 6087

Whole sequence top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: