Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
76 projects found  

4 accessions found for Burkholderia phymatum STM815  

Data for CP001043  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001043.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001043_1497 CDS_1705096-1706640 57.0 1.3e-16 1
CP001043_1084 CDS_1234524-1233043 54.0 9.5e-16 1
CP001043_1137 CDS_1285407-1286879 50.7 8.9e-15 2
CP001043_0096 CDS_108543-107677 33.6 1e-09 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001043_1497 1/1 269 336 .. 1 70 [] 57.0 1.3e-16
CP001043_1084 1/1 288 357 .. 1 70 [] 54.0 9.5e-16
CP001043_1137 2/2 284 352 .. 1 70 [] 49.5 2e-14
CP001043_0096 1/1 64 127 .. 1 58 [. 33.6 1e-09

Alignments of top-scoring domains:
CP001043_1497: domain 1 of 1, from 269 to 336: score 57.0, E = 1.3e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E + +ARELHD++g L+a k+ + +arr l +++ + ++e l+++
CP001043_1 269 EKTQLARELHDELGAILTASKMDVAWARRKL--QEAEPVVAEKLTRA 313

relarealaevRrllgdLRpaal<-*
+++++++a Rr++ d+Rp++l
CP001043_1 314 LATLDQGIALKRRIIEDMRPTVL 336

CP001043_1084: domain 1 of 1, from 288 to 357: score 54.0, E = 9.5e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe..eareald
E +RIARELHD +gQ+L+a+k+ + +++ + ++ + e ++ ++
CP001043_1 288 EKKRIARELHDDLGQQLTALKMSAVILQQDV--EAGHYtaETAAKAR 332

eirelarealaevRrllgdLRpaal<-*
+ a+++++ +Rr++++LRp+ l
CP001043_1 333 GLVVQADDTMSALRRIASNLRPTML 357

CP001043_1137: domain 2 of 2, from 284 to 352: score 49.5, E = 2e-14
*->ERaRIARELHDsvgQsLsaiklq.lelarrlldsdkdpeearealde
E aRIARELHD +gQ+L+a+k+ + r++ d d+++a + + +
CP001043_1 284 EKARIARELHDDLGQQLAALKIEcAKNGNRAT--DIDAPKAGADMNN 328

irelarealaevRrllgdLRpaal<-*
i +l+++ vRr+++dLRpa l
CP001043_1 329 IYALIDQLVVSVRRIATDLRPAML 352

CP001043_0096: domain 1 of 1, from 64 to 127: score 33.6, E = 1e-09
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe........e
R+R A+ELHDs+g +a++ l ++++ l ++d++++ + +
CP001043_0 64 TRRRVAQELHDSLGAEVTAARFALAGVETWL--PADAPpqctaalqT 108

arealdeirelarealaev<-*
a++ ld++ ++a+ea ae+
CP001043_0 109 AQRSLDAVTQAAQEAVAEL 127


Histogram of all scores:
score obs exp (one = represents 10 sequences)
----- --- ---
-14 7 0|=
-13 27 0|===
-12 73 34|===*====
-11 142 281|=============== *
-10 422 653|=========================================== *
-9 532 741|====================================================== *
-8 445 571|============================================= *
-7 414 359|===================================*======
-6 349 203|====================*==============
-5 270 109|==========*================
-4 152 56|=====*==========
-3 90 29|==*======
-2 66 14|=*=====
-1 29 7|*==
0 15 3|*=
1 19 1|*=
2 5 0|=
3 1 0|=
4 4 0|=
5 1 0|=
6 1 0|=
7 3 0|=
> 8 5 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1150.0638
P(chi-square) = 0

Total sequences searched: 3072

Whole sequence top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: