Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
76 projects found  

4 accessions found for Burkholderia phymatum STM815  

Data for CP001044  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP001044.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001044_1371 CDS_1579872-1584878 134.4 2.8e-38 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001044_1371 1/1 1473 1561 .. 1 94 [] 134.4 2.8e-38

Alignments of top-scoring domains:
CP001044_1371: domain 1 of 1, from 1473 to 1561: score 134.4, E = 2.8e-38
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHRVKNNLQ+ISSLL+LQa++++d++v e++ +s+nRV+S
CP001044_1 1473 EVHHRVKNNLQLISSLLNLQAERVTDKAV-----AELFADSRNRVRS 1514

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mA++HE LY+ +++ ++ + ++ L+++L ++y g+ g++L D+
CP001044_1 1515 MAMVHENLYRAGNFARIAMTTHVKTLCGHLARAYDMGRLGVDLQIDV 1561


Histogram of all scores:
score obs exp (one = represents 11 sequences)
----- --- ---
-15 3 0|=
-14 16 0|==
-13 42 14|=*==
-12 149 154|=============*
-11 622 429|======================================*==================
-10 531 555|================================================= *
-9 367 469|================================== *
-8 270 315|========================= *
-7 140 187|============= *
-6 113 104|=========*=
-5 47 56|=====*
-4 26 29|==*
-3 9 15|=*
-2 4 8|*
-1 2 4|*
0 4 2|*
1 1 1|*
> 2 3 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 184.2724
P(chi-square) = 3.036e-34

Total sequences searched: 2349

Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: