Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
76 projects found  

4 accessions found for Burkholderia phymatum STM815  

Data for CP001045  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001045.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001045_0969 CDS_1145447-1143822 76.2 1.5e-22 1
CP001045_0413 CDS_497696-495879 73.7 7.7e-22 1
CP001045_0882 CDS_1051873-1050458 64.4 4.2e-19 1
CP001045_0620 CDS_746747-748630 60.6 5.6e-18 1
CP001045_0257 CDS_318350-317250 48.3 2.4e-14 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001045_0969 1/1 340 406 .. 1 70 [] 76.2 1.5e-22
CP001045_0413 1/1 392 462 .. 1 70 [] 73.7 7.7e-22
CP001045_0882 1/1 253 323 .. 1 70 [] 64.4 4.2e-19
CP001045_0620 1/1 422 490 .. 1 70 [] 60.6 5.6e-18
CP001045_0257 1/1 163 232 .. 1 70 [] 48.3 2.4e-14

Alignments of top-scoring domains:
CP001045_0969: domain 1 of 1, from 340 to 406: score 76.2, E = 1.5e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIA E+HD++gQ L+a+k+ ++l++++l + dp ea + +d +
CP001045_0 340 ERKRIAMEIHDELGQLLTALKMDVSLLKMRL--AHDP-EATKKADDM 383

relarealaevRrllgdLRpaal<-*
rel++ ++ vR+++++LRpaal
CP001045_0 384 RELVEGTIWMVRNVASHLRPAAL 406

CP001045_0413: domain 1 of 1, from 392 to 462: score 73.7, E = 7.7e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe....earea
ER+ IARELHDs++QsLs +k+ql +++++l +pe +++ ++e
CP001045_0 392 ERNAIARELHDSLAQSLSYMKIQLARLQAVL----PPElsqsDIAEI 434

ldeirelarealaevRrllgdLR.paal<-*
++ ire ++ a++++R+ll+++R+p+
CP001045_0 435 ARGIREGIDSAYRQLRELLTTFRsPMHA 462

CP001045_0882: domain 1 of 1, from 253 to 323: score 64.4, E = 4.2e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrllds.dkdpeearealde
ERaR++RELHD+++Q+L ++kl le a+++++ ++ ++a++al +
CP001045_0 253 ERARLSRELHDGISQMLVSVKLLLESALARFELsEPRVQPAEAALST 299

irelarealaevRrllgdLRpaal<-*
+ + +al+evRr+ ++LRp+ l
CP001045_0 300 GIGRLGDALREVRRISHALRPSML 323

CP001045_0620: domain 1 of 1, from 422 to 490: score 60.6, E = 5.6e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER IARELHDs++QsL+ +k+q+ l+r +l +kd ++ ++a+ e+
CP001045_0 422 ERGFIARELHDSIAQSLAFMKIQSVLLRDALA-QKDTAKTERAVGEL 467

relarealaevRrllgdLRpaal<-*
+ ++e+l++vR+ll ++R+ +
CP001045_0 468 EMGIEESLSDVRELLMHFRTRTN 490

CP001045_0257: domain 1 of 1, from 163 to 232: score 48.3, E = 2.4e-14
*->ERaRIARELHDsvgQsLsaiklqlelarrllds.dkdpeearealde
E +RIARELHD +gQ+L+a+k+ + l+++ l +++d + + + ++
CP001045_0 163 EQKRIARELHDDLGQQLTALKMSVALIEATL-AqKDDTAHLVPQTHA 208

irelarealaevRrllgdLRpaal<-*
+++ ++ +Rr++ dLRp+ l
CP001045_0 209 LQKEIDAMAMSLRRIAADLRPPLL 232


Histogram of all scores:
score obs exp (one = represents 6 sequences)
----- --- ---
-14 3 0|=
-13 14 0|===
-12 45 18|==*=====
-11 55 149|========== *
-10 185 345|=============================== *
-9 316 392|===================================================== *
-8 246 302|========================================= *
-7 224 190|===============================*======
-6 189 107|=================*==============
-5 155 57|=========*================
-4 68 30|====*=======
-3 49 15|==*======
-2 22 7|=*==
-1 18 4|*==
0 12 2|*=
1 9 1|*=
2 4 0|=
3 3 0|=
4 2 0|=
5 0 0|
> 6 7 -|==


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 575.3218
P(chi-square) = 0

Total sequences searched: 1626

Whole sequence top hits:
tophits_s report:
Total hits: 5
Satisfying E cutoff: 5
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 5
Satisfying E cutoff: 5
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: