Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
76 projects found  

4 accessions found for Burkholderia phymatum STM815  

Data for CP001046  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001046.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001046_0398 CDS_527695-522266 86.7 3.1e-26 1
CP001046_0346 CDS_464585-466210 74.0 1.7e-22 1
CP001046_0401 CDS_530950-532410 64.7 1e-19 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001046_0398 1/1 1613 1680 .. 1 70 [] 86.7 3.1e-26
CP001046_0346 1/1 340 406 .. 1 70 [] 74.0 1.7e-22
CP001046_0401 1/1 268 338 .. 1 70 [] 64.7 1e-19

Alignments of top-scoring domains:
CP001046_0398: domain 1 of 1, from 1613 to 1680: score 86.7, E = 3.1e-26
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD++gQ+L+a++l l+++++ l +d +++ e+ +++
CP001046_0 1613 ERKRIAREMHDELGQHLTALRLRLSALQMKL--YTDCPKLVEQTQAL 1657

relarealaevRrllgdLRpaal<-*
l++++++ vR +++ LRpaal
CP001046_0 1658 VSLVDQTMQVVRGVITSLRPAAL 1680

CP001046_0346: domain 1 of 1, from 340 to 406: score 74.0, E = 1.7e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIA E+HD++gQ L+a+k+ ++l++++l + dpe+ + d +
CP001046_0 340 ERKRIAMEIHDELGQLLTALKMDVSLLKMRL--TQDPEAMK-KTDDM 383

relarealaevRrllgdLRpaal<-*
rel++ ++ vR+++++LRpaal
CP001046_0 384 RELVEGTIWMVRNVASHLRPAAL 406

CP001046_0401: domain 1 of 1, from 268 to 338: score 64.7, E = 1e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrllds.dkdpeearealde
ERaR++RELHD+++Q+L ++kl le a+++++ +++ + a++al +
CP001046_0 268 ERARLSRELHDGISQMLVSVKLLLESALARFELsATRVPSAEAALSM 314

irelarealaevRrllgdLRpaal<-*
+ + +al+evRr+ ++LRp+ l
CP001046_0 315 GITRLADALREVRRISHALRPSML 338


Histogram of all scores:
score obs exp (one = represents 2 sequences)
----- --- ---
-13 9 0|=====
-12 8 5|==*=
-11 24 41|============ *
-10 53 95|=========================== *
-9 78 108|======================================= *
-8 75 83|====================================== *
-7 66 52|=========================*=======
-6 41 29|==============*======
-5 41 15|=======*=============
-4 22 8|===*=======
-3 8 4|=*==
-2 4 2|*=
-1 8 1|*===
0 1 0|=
1 3 0|==
> 2 8 -|====


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 106.7943
P(chi-square) = 1.734e-19

Total sequences searched: 449

Whole sequence top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: