hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001052.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001052_2602 CDS_3005226-3006710 56.1 2.9e-16 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001052_2602 1/1 277 344 .. 1 70 [] 56.1 2.9e-16
Alignments of top-scoring domains:
CP001052_2602: domain 1 of 1, from 277 to 344: score 56.1, E = 2.9e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E + +ARELHD++g L+a k+ + +a r l ++ + +++ l+++
CP001052_2 277 EKTQLARELHDELGAILTASKMDVAWANRKL--KDSEPDIADKLKRA 321
relarealaevRrllgdLRpaal<-*
+ +++++a Rr++ d+Rp++l
CP001052_2 322 LANLDQGIALKRRIIEDMRPTVL 344
Histogram of all scores:
score obs exp (one = represents 12 sequences)
----- --- ---
-14 7 0|=
-13 51 0|=====
-12 104 43|===*=====
-11 166 359|============== *
-10 525 834|============================================ *
-9 674 947|========================================================= *
-8 588 729|================================================= *
-7 523 458|======================================*=====
-6 440 259|=====================*===============
-5 360 139|===========*==================
-4 182 72|=====*==========
-3 125 37|===*=======
-2 72 19|=*====
-1 44 9|*===
0 21 4|*=
1 15 2|*=
2 9 1|*
3 5 0|=
4 4 0|=
5 2 0|=
6 2 0|=
> 7 3 -|=
% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1527.8064
P(chi-square) = 0
Total sequences searched: 3922
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K