Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
76 projects found  

3 accessions found for Burkholderia phytofirmans PsJN  

Data for CP001053  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001053.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001053_2194 CDS_2494891-2492645 73.5 1.7e-21 1
CP001053_2266 CDS_2578739-2580085 70.4 1.5e-20 1
CP001053_2189 CDS_2488089-2486428 63.4 1.6e-18 1
CP001053_0478 CDS_547658-546243 62.9 2.3e-18 1
CP001053_1528 CDS_1757128-1756016 39.5 1.8e-11 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001053_2194 1/1 549 616 .. 1 70 [] 73.5 1.7e-21
CP001053_2266 1/1 240 308 .. 1 70 [] 70.4 1.5e-20
CP001053_2189 1/1 346 412 .. 1 70 [] 63.4 1.6e-18
CP001053_0478 1/1 253 323 .. 1 70 [] 62.9 2.3e-18
CP001053_1528 1/1 160 231 .. 1 70 [] 39.5 1.8e-11

Alignments of top-scoring domains:
CP001053_2194: domain 1 of 1, from 549 to 616: score 73.5, E = 1.7e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD++gQ+L+a++l++++ r + + d+++++ +++ +
CP001053_2 549 ERKRIAREMHDELGQQLTALRLGVSAMRIEF--AQDDPALAGRFRDL 593

relarealaevRrllgdLRpaal<-*
+la+++++ vR+++ LRpaa
CP001053_2 594 LALADDTMQVVRNVVASLRPAAI 616

CP001053_2266: domain 1 of 1, from 240 to 308: score 70.4, E = 1.5e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.earealde
E +RIARELHD +gQ+L+a+k+ ++ ++++l d+ ++ ++r++l+
CP001053_2 240 EKTRIARELHDDLGQQLTALKMDISSVEQAL--DASAGaAVRDQLHG 284

irelarealaevRrllgdLRpaal<-*
+r+l++++ a vRr++ dLRp l
CP001053_2 285 MRRLIDTTVASVRRIAADLRPVML 308

CP001053_2189: domain 1 of 1, from 346 to 412: score 63.4, E = 1.6e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIA E+HD++gQ L+a+k+ ++l++++l kdp++ r +d +
CP001053_2 346 ERKRIAMEIHDELGQLLTALKMDVSLLKMRL--GKDPDAMR-KADDM 389

relarealaevRrllgdLRpaal<-*
rel+++++ v +++ +LRp al
CP001053_2 390 RELVEKTIWMVCNVANHLRPVAL 412

CP001053_0478: domain 1 of 1, from 253 to 323: score 62.9, E = 2.3e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe..eareald
ERaR++RELHD+++Q++ ++kl le a+++++ +++ ++a++al+
CP001053_0 253 ERARLSRELHDGISQMMVSVKLLLESALARFE-RSEVRvpAAEAALT 298

eirelarealaevRrllgdLRpaal<-*
+ + + ++l+evRr+ ++LRp+ l
CP001053_0 299 TSLTRLGDTLREVRRISHALRPSML 323

CP001053_1528: domain 1 of 1, from 160 to 231: score 39.5, E = 1.8e-11
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RIARELHD +gQ+++a+k+ l l ++ l + e+ r++l +
CP001053_1 160 EQRRIARELHDDLGQQITALKMTLALHETELA-RHFSEAGRARLGSV 205

relarealae...vRrllgdLRpaal<-*
re+a++ a +++Rr++ dLRp+ l
CP001053_1 206 REMADQLDAMatsMRRIAADLRPPML 231


Histogram of all scores:
score obs exp (one = represents 10 sequences)
----- --- ---
-15 1 0|=
-14 5 0|=
-13 47 0|=====
-12 65 35|===*===
-11 136 288|============== *
-10 363 670|===================================== *
-9 558 761|======================================================== *
-8 532 586|====================================================== *
-7 451 368|====================================*=========
-6 326 208|====================*============
-5 281 111|===========*=================
-4 155 58|=====*==========
-3 95 30|==*=======
-2 63 15|=*=====
-1 29 7|*==
0 15 3|*=
1 10 2|*
2 7 1|*
3 2 0|=
4 2 0|=
5 2 0|=
> 6 7 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1150.7200
P(chi-square) = 0

Total sequences searched: 3152

Whole sequence top hits:
tophits_s report:
Total hits: 5
Satisfying E cutoff: 5
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 5
Satisfying E cutoff: 5
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: