Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
76 projects found  

3 accessions found for Ralstonia pickettii 12J  

Data for CP001068  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001068.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001068_3679 CDS_3907738-3909204 66.1 3.1e-19 1
CP001068_0138 CDS_160751-162208 65.9 3.6e-19 1
CP001068_3378 CDS_3589919-3591055 59.6 2.5e-17 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001068_3679 1/1 263 336 .. 1 70 [] 66.1 3.1e-19
CP001068_0138 1/1 252 319 .. 1 70 [] 65.9 3.6e-19
CP001068_3378 1/1 163 233 .. 1 70 [] 59.6 2.5e-17

Alignments of top-scoring domains:
CP001068_3679: domain 1 of 1, from 263 to 336: score 66.1, E = 3.1e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe......ear
ERaR +RELHD+++Q L + kl le+a+ +l ++ ++++++ ++a
CP001068_3 263 ERARVSRELHDGISQVLVSTKLLLETAHGHL--EASAAsptsieRAG 307

ealdeirelarealaevRrllgdLRpaal<-*
l+++ + ++ al evRr+ ++LRpa l
CP001068_3 308 SMLRRALDRLNGALGEVRRVSHNLRPALL 336

CP001068_0138: domain 1 of 1, from 252 to 319: score 65.9, E = 3.6e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +R+ARELHD++g L+a k+ l+++r ++ +++ +++ e ++++
CP001068_0 252 EKTRLARELHDELGAILTATKMDLHWLRSRI--HANEPAVSEKITRV 296

relarealaevRrllgdLRpaal<-*
+++++++++ Rrl+ dLRp++l
CP001068_0 297 MAHVDQGIQIKRRLIEDLRPTIL 319

CP001068_3378: domain 1 of 1, from 163 to 233: score 59.6, E = 2.5e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe...eareal
E +RIARELHD +gQ+L+a+k+ + ++++ + pe are+
CP001068_3 163 EKKRIARELHDDLGQQLTALKMIITALLADD--STTPEalaYARERT 207

deirelarealaevRrllgdLRpaal<-*
++ +++++ala vRrl+ +LRp+ l
CP001068_3 208 LAMSHAIDHALASVRRLAAGLRPTML 233


Histogram of all scores:
score obs exp (one = represents 11 sequences)
----- --- ---
-14 10 0|=
-13 51 0|=====
-12 95 41|===*=====
-11 165 339|=============== *
-10 480 788|============================================ *
-9 649 895|==========================================================*
-8 515 690|=============================================== *
-7 503 434|=======================================*======
-6 399 245|======================*==============
-5 346 131|===========*====================
-4 193 68|======*===========
-3 115 35|===*=======
-2 68 18|=*=====
-1 48 9|*====
0 34 4|*===
1 13 2|*=
2 6 1|*
3 8 0|=
4 5 0|=
5 1 0|=
6 0 0|
7 0 0|
> 8 5 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1553.0118
P(chi-square) = 0

Total sequences searched: 3709

Whole sequence top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: