Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
76 projects found  

3 accessions found for Ralstonia pickettii 12J  

Data for CP001069  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001069.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001069_0612 CDS_701759-703507 70.2 6.2e-21 1
CP001069_0645 CDS_736242-734854 67.6 3.4e-20 1
CP001069_0883 CDS_1006900-1008855 62.5 1.1e-18 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001069_0612 1/1 365 432 .. 1 70 [] 70.2 6.2e-21
CP001069_0645 1/1 253 322 .. 1 70 [] 67.6 3.4e-20
CP001069_0883 1/1 446 514 .. 1 70 [] 62.5 1.1e-18

Alignments of top-scoring domains:
CP001069_0612: domain 1 of 1, from 365 to 432: score 70.2, E = 6.2e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R++RELHD+++QsL+a+k+ ++++++ l d+ +++++e+l ++
CP001069_0 365 ERRRLSRELHDELAQSLAALKVDMQMLEHKL--DATNAPVAERLSAM 409

relarealaevRrllgdLRpaal<-*
++++++ ++ +Rrl++dLRp+ l
CP001069_0 410 EHAVDDMIRATRRLASDLRPSML 432

CP001069_0645: domain 1 of 1, from 253 to 322: score 67.6, E = 3.4e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARELHD +gQ+Lsa+k+ ++l+++ l+ ++ + ++ ++ +++
CP001069_0 253 ERHRIARELHDDLGQRLSALKMDISLLAADLQAARSDKALIDQTQAM 299

relarealaevRrllgdLRpaal<-*
++ ++e++ vR++ dLRp+ l
CP001069_0 300 QHVIDETIVAVRHISADLRPPLL 322

CP001069_0883: domain 1 of 1, from 446 to 514: score 62.5, E = 1.1e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ A+ LHDs++Q+L ++lq++++ ++++ d++ +eare + +
CP001069_0 446 ERNLVAQGLHDSIAQGLNFLNLQVQMLDAAMR-DANLDEAREIVPLL 491

relarealaevRrllgdLRpaal<-*
r ++e++++vR+ll ++R +
CP001069_0 492 RCGVEESYQDVRELLLNFRSKLE 514


Histogram of all scores:
score obs exp (one = represents 4 sequences)
----- --- ---
-14 3 0|=
-13 16 0|====
-12 23 12|==*===
-11 44 105|=========== *
-10 125 245|================================ *
-9 209 278|===================================================== *
-8 150 214|====================================== *
-7 162 134|=================================*=======
-6 129 76|==================*==============
-5 115 40|=========*===================
-4 64 21|=====*==========
-3 48 10|==*=========
-2 17 5|=*===
-1 14 2|*===
0 13 1|*===
1 5 0|==
2 3 0|=
3 3 0|=
4 4 0|=
5 1 0|=
6 0 0|
> 7 5 -|==


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 547.8168
P(chi-square) = 0

Total sequences searched: 1153

Whole sequence top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: