Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

4 accessions found for Rhizobium etli CIAT 652  

Data for CP001074  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP001074.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001074_2587 CDS_2633411-2632347 98.9 6.5e-28 1
CP001074_0464 CDS_483250-482174 84.3 9e-24 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001074_2587 1/1 159 243 .. 1 94 [] 98.9 6.5e-28
CP001074_0464 1/1 162 250 .. 1 94 [] 84.3 9e-24

Alignments of top-scoring domains:
CP001074_2587: domain 1 of 1, from 159 to 243: score 98.9, E = 6.5e-28
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E++HR+ N+L ++ +L+r+Q+ +kd+ + ++aL+E+q R+ +
CP001074_2 159 EVNHRIANSLGLVGALIRMQSAMTKDQVA-----IDALHETQMRINA 200

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A +H++LY+++ +++v ++eYl+ L+ +L s+++++ ++ +
CP001074_2 201 IASVHRRLYTNRQVGSVQLDEYLNSLLTELEASMRDDKRPHR----I 243

CP001074_0464: domain 1 of 1, from 162 to 250: score 84.3, E = 9e-24
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E +HRVKNNLQ+I++L+r++ar+++ e e + +R+ +
CP001074_0 162 ELQHRVKNNLQMITALIRMEARNAQKNEE-----SERFARLAGRIEA 203

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
Al+++ L+ e t+d+++Y++ ++++ + +++v++++++ k+D+
CP001074_0 204 LALLYRALSDEEKGATIDLGSYVSQIAASVMAAHAVEGIRLDMKVDT 250


Histogram of all scores:
score obs exp (one = represents 21 sequences)
----- --- ---
-15 3 0|=
-14 27 0|==
-13 81 27|=*==
-12 276 285|=============*
-11 1198 794|=====================================*====================
-10 950 1027|============================================== *
-9 682 868|================================= *
-8 461 582|====================== *
-7 241 345|============ *
-6 230 192|=========*=
-5 87 103|====*
-4 40 54|==*
-3 29 28|=*
-2 16 15|*
-1 8 7|*
0 7 4|*
1 2 2|*
2 1 1|*
3 0 0|
4 0 0|
5 1 0|=
6 0 0|
> 7 3 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 428.9883
P(chi-square) = 0

Total sequences searched: 4358

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: