Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

4 accessions found for Rhizobium etli CIAT 652  

Data for CP001074  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP001074.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001074_3479 CDS_3542612-3543565 139.5 2.5e-47 1
CP001074_3488 CDS_3551300-3553864 120.5 7.6e-41 1
CP001074_3827 CDS_3929245-3930897 80.1 4.2e-27 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001074_3479 1/1 120 202 .. 1 85 [] 139.5 2.5e-47
CP001074_3488 1/1 522 604 .. 1 85 [] 120.5 7.6e-41
CP001074_3827 1/1 357 438 .. 1 85 [] 80.1 4.2e-27

Alignments of top-scoring domains:
CP001074_3479: domain 1 of 1, from 120 to 202: score 139.5, E = 2.5e-47
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR+KN+LA++Q+ia+QT+Rn+ sld+f+ +F+gRLq+Ls+++dL
CP001074_3 120 ELSHRSKNLLAIIQGIATQTARNTLSLDSFLLKFRGRLQSLSNSQDL 166

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
+t+s+W+gA L+eL+e ++aPy++e ++ + G +
CP001074_3 167 --ITDSSWRGAYLFELAEKQFAPYWPETSGSMPIYGIN 202

CP001074_3488: domain 1 of 1, from 522 to 604: score 120.5, E = 7.6e-41
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRV+N+L+++ +i+rQ+ ++ sl ++ ++++gR q+L+raHd+
CP001074_3 522 ELNHRVRNILSLITGIIRQSQATSVSLGDYIRQIEGRVQSLARAHDQ 568

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
+tr++Wa+A+Lr+Ll ae a+y g+ a+Ri++ G+d
CP001074_3 569 --ITRDHWAPASLRQLLLAETAAYLGKNAQRIQMRGED 604

CP001074_3827: domain 1 of 1, from 357 to 438: score 80.1, E = 4.2e-27
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL HR KN+L++ Q+++rQ +++a+s++ f +a+++RL L+r+ L
CP001074_3 357 ELVHRTKNLLTLAQAMMRQLAKQADSVETFQAAVADRLDGLGRSIEL 403

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Lt ++W+g++Lr ++ + L+++ + +e+i++ G+d
CP001074_3 404 --LTSEQWGGVSLRRVVDIHLQAFPQS-REQIEIAGED 438


Histogram of all scores:
score obs exp (one = represents 14 sequences)
----- --- ---
-15 1 0|=
-14 7 0|=
-13 72 0|======
-12 380 0|============================
-11 478 35|==*================================
-10 695 449|================================*=================
-9 732 1111|===================================================== *
-8 797 1153|========================================================= *
-7 480 775|=================================== *
-6 273 423|==================== *
-5 191 209|==============*
-4 109 99|=======*
-3 52 46|===*
-2 33 21|=*=
-1 20 9|*=
0 12 4|*
1 3 2|*
2 2 0|=
> 3 6 -|=


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 6078.1914
P(chi-square) = 0

Total sequences searched: 4358

Whole sequence top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: