Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

4 accessions found for Rhizobium etli CIAT 652  

Data for CP001076  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP001076.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001076_0071 CDS_84980-83964 97.5 4.6e-34 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001076_0071 1/1 142 223 .. 1 85 [] 97.5 4.6e-34

Alignments of top-scoring domains:
CP001076_0071: domain 1 of 1, from 142 to 223: score 97.5, E = 4.6e-34
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR+KNtLAvVQ+i +Q++Rnaas++++ +++s R+ A ++aHd+
CP001076_0 142 ELSHRIKNTLAVVQAITNQSFRNAASIEAAEQSISSRIKAYANAHDI 188

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L + +W +A ++ea+ g e + Ri sGP+
CP001076_0 189 --LLQKNWLSAAVDTIIEATTVNLGVE-PSRIKASGPA 223


Histogram of all scores:
score obs exp (one = represents 2 sequences)
----- --- ---
-14 1 0|=
-13 11 0|======
-12 39 0|====================
-11 39 2|*===================
-10 59 36|=================*============
-9 59 91|============================== *
-8 67 94|================================== *
-7 34 63|================= *
-6 27 34|============== *
-5 7 17|==== *
-4 7 8|===*
-3 1 3|=*
-2 2 1|*
-1 0 0|
0 0 0|
> 1 3 -|==


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 54.3748
P(chi-square) = 6.199e-10

Total sequences searched: 379

Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: