Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

4 accessions found for Rhizobium etli CIAT 652  

Data for CP001077  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP001077.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001077_0067 CDS_64921-66615 87.1 4e-30 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001077_0067 1/1 362 442 .. 1 85 [] 87.1 4e-30

Alignments of top-scoring domains:
CP001077_0067: domain 1 of 1, from 362 to 442: score 87.1, E = 4e-30
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL HRVKN +++VQ+iarQT +++s +e +F+ RL+AL+++ dL
CP001077_0 362 ELAHRVKNGFTLVQAIARQT--FSRSDPERYNSFAERLAALAGTYDL 406

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
+ +e++ re+++a+L+++ + +aeRi+l+GP+
CP001077_0 407 --ILSREGSASPVREIVSAALRAHVASQAERIRLDGPE 442


Histogram of all scores:
score obs exp (one = represents 3 sequences)
----- --- ---
-13 11 0|====
-12 76 0|==========================
-11 92 7|==*============================
-10 143 100|=================================*==============
-9 174 249|==========================================================*
-8 177 259|==========================================================*
-7 128 174|=========================================== *
-6 52 95|================== *
-5 47 47|===============*
-4 36 22|=======*====
-3 19 10|===*===
-2 12 4|=*==
-1 6 2|*=
> 0 3 -|=


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 999.1604
P(chi-square) = 0

Total sequences searched: 989

Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: