Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
35 projects found  

2 accessions found for Desulfobacterium autotrophicum HRM2  

Data for CP001087  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001087.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001087_1357 CDS_1558110-1560236 62.3 5.3e-18 1
CP001087_1414 CDS_1633407-1635080 48.9 4.9e-14 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001087_1357 1/1 507 574 .. 1 70 [] 62.3 5.3e-18
CP001087_1414 1/1 349 416 .. 1 70 [] 48.9 4.9e-14

Alignments of top-scoring domains:
CP001087_1357: domain 1 of 1, from 507 to 574: score 62.3, E = 5.3e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER +ARELHD +gQ L+a+k+ + +++r l ++ a+ ++ +i
CP001087_1 507 ERGALARELHDHLGQVLTALKIDAVWIERFL--SPRDPDAAVRAGRI 551

relarealaevRrllgdLRpaal<-*
l+++++ +vR ++ +LRp++l
CP001087_1 552 SSLIDDTIGDVRKMAFRLRPGVL 574

CP001087_1414: domain 1 of 1, from 349 to 416: score 48.9, E = 4.9e-14
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ IA LHD +gQsL+++klq+ ++++ + +kd a++ +
CP001087_1 349 ERKKIAYMLHDDLGQSLTLLKLQIRAIEMKI--EKDGKGAKADCCLA 393

relarealaevRrllgdLRpaal<-*
++ ++++++ vR++ + L p++l
CP001087_1 394 MKNISKTIENVREISHSLTPSIL 416


Histogram of all scores:
score obs exp (one = represents 18 sequences)
----- --- ---
-14 25 0|==
-13 153 0|=========
-12 223 54|==*==========
-11 298 446|================= *
-10 895 1035|================================================== *
-9 1031 1176|==========================================================*
-8 738 906|========================================= *
-7 527 569|============================== *
-6 379 322|=================*====
-5 297 173|=========*=======
-4 132 90|====*===
-3 63 46|==*=
-2 42 23|=*=
-1 30 12|*=
0 11 6|*
1 10 3|*
2 6 1|*
3 2 0|=
4 1 0|=
5 1 0|=
> 6 7 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 811.7645
P(chi-square) = 0

Total sequences searched: 4871

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: