Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

1 accessions found for Bifidobacterium longum subsp. infantis ATCC 15697  

Data for CP001095  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001095.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001095_1575 CDS_1784595-1785950 71.2 6.5e-21 1
CP001095_1632 CDS_1846652-1849030 69.8 1.7e-20 3
CP001095_1003 CDS_1228151-1229536 51.8 3.4e-15 1
CP001095_0442 CDS_535146-533884 50.0 1.1e-14 1
CP001095_1364 CDS_1579024-1577756 46.1 1.6e-13 1
CP001095_0450 CDS_543882-542509 43.4 9.7e-13 1
CP001095_0460 CDS_553523-552198 40.9 5.6e-12 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001095_1575 1/1 216 285 .. 1 70 [] 71.2 6.5e-21
CP001095_1003 1/1 242 309 .. 1 70 [] 51.8 3.4e-15
CP001095_1632 1/3 239 297 .. 1 61 [. 51.5 4.1e-15
CP001095_0442 1/1 203 267 .. 2 70 .] 50.0 1.1e-14
CP001095_1364 1/1 208 267 .. 2 65 .. 46.1 1.6e-13
CP001095_0450 1/1 221 283 .. 8 70 .] 43.4 9.7e-13
CP001095_0460 1/1 219 288 .. 2 70 .] 40.9 5.6e-12

Alignments of top-scoring domains:
CP001095_1575: domain 1 of 1, from 216 to 285: score 71.2, E = 6.5e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD vg+ L+ +++q+++ r++++ ++++ a++ ++++
CP001095_1 216 ERTRIAREIHDNVGHLLTRAIMQAQAGRTVAE-ATNDTVAAQGFATL 261

relarealaevRrllgdLR.paal<-*
+++++a++ vRr ++dL +++++
CP001095_1 262 GATLDDAMTMVRRSVHDLEdDGTD 285

CP001095_1003: domain 1 of 1, from 242 to 309: score 51.8, E = 3.4e-15
*->ERaR..IARELHDsvgQsLsaiklqlelarrlldsdkdpeeareald
ER+R + A ELHDsvg++L+ai+ +e+++ l+ e+++ a++
CP001095_1 242 ERRRadVAAELHDSVGHNLTAIIALTEGLEGLT-----QEPVEGAIK 283

eirelarealaevRrllgdLR.paal<-*
i lar++l ++R++++ L +p +l
CP001095_1 284 SINNLARQSLGDTREAVRKLSsPVTL 309

CP001095_1632: domain 1 of 3, from 239 to 297: score 51.5, E = 4.1e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIAR++HD+v+++Ls i++q+++ r++ + d + a+ ++ +i
CP001095_1 239 ERARIARDMHDVVAHTLSTIIVQSDGGRYAG--AHDLAIAKHTMGTI 283

relarealaevRrl<-*
r+ a++a+ ++ rl
CP001095_1 284 RHEAERAQHDMQRL 297

CP001095_0442: domain 1 of 1, from 203 to 267: score 50.0, E = 1.1e-14
*->RaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdeir
R RIA LHDsvg++L+ai+ +e++ + + +++eal+ i
CP001095_0 203 RSRIAGQLHDSVGHGLTAIIALSEGLTGKT--GDS--RVEEALKGIN 245

elarealaevRrllgdLRpaal<-*
e+are+l+++R ++++L +++
CP001095_0 246 EIARESLEDTRKAVRALTETDT 267

CP001095_1364: domain 1 of 1, from 208 to 267: score 46.1, E = 1.6e-13
*->RaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdeir
R RIA LHDsvgQ L++i+ +e+++ ++d++++++al+ i
CP001095_1 208 RSRIAGQLHDSVGQDLTVIIALSEGLAG----KTDDPRVEDALHGIN 250

elarealaevRrllgdL<-*
e+are+l ++R ++++L
CP001095_1 251 EIARESLGDTRKAVRAL 267

CP001095_0450: domain 1 of 1, from 221 to 283: score 43.4, E = 9.7e-13
*->ELHDsvgQsLsaiklqlelarrlldsdkdpe.earealdeirelare
E+HDsvg+ L++i+ +++++ +++ d ++e+++a+d+ir++a+
CP001095_0 221 EMHDSVGHDLTSIIALAQGLAEQVE-GQDVDpEVAQAIDAIRDIAKS 266

alaevRrllgdLRpaal<-*
+l+++R++l++L ++
CP001095_0 267 GLQDTRHALRALTATDA 283

CP001095_0460: domain 1 of 1, from 219 to 288: score 40.9, E = 5.6e-12
*->RaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe...eareald
R R+A ELHDsvg++L++i+ +++ + + + +++++++ l+
CP001095_0 219 RLRMANELHDSVGHGLTSIIALSQGGEDCI--RNGGYsdsQLADVLA 263

eirelarealaevRrllgdLRpaal<-*
ei +a+++l ++Rr+l ++ + +
CP001095_0 264 EITSIAKDSLGDTRRILKVFNEEES 288


Histogram of all scores:
score obs exp (one = represents 8 sequences)
----- --- ---
-14 2 0|=
-13 38 0|=====
-12 64 26|===*====
-11 130 221|================= *
-10 371 513|=============================================== *
-9 455 583|========================================================= *
-8 351 449|============================================ *
-7 298 282|===================================*==
-6 229 160|===================*=========
-5 220 85|==========*=================
-4 90 44|=====*======
-3 53 23|==*====
-2 42 11|=*====
-1 28 5|*===
0 14 3|*=
1 8 1|*
2 5 0|=
3 2 0|=
4 1 0|=
5 1 0|=
6 2 0|=
7 1 0|=
8 2 0|=
9 0 0|
10 0 0|
> 11 9 -|==


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 661.4816
P(chi-square) = 0

Total sequences searched: 2416

Whole sequence top hits:
tophits_s report:
Total hits: 7
Satisfying E cutoff: 7
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 7
Satisfying E cutoff: 7
Total memory: 23K


Acknowledgements:

This research is funded by:

Developed by: