Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

1 accessions found for Rhodopseudomonas palustris TIE-1  

Data for CP001096  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP001096.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001096_4635 CDS_5066199-5064529 129.4 8.5e-44 1
CP001096_3069 CDS_3372094-3373152 122.9 1.3e-41 1
CP001096_1159 CDS_1255872-1253332 116.8 1.7e-39 1
CP001096_0007 CDS_10430-8982 115.6 4.1e-39 1
CP001096_3676 CDS_4002282-4005419 111.4 1.1e-37 1
CP001096_2316 CDS_2551719-2549818 108.3 1.3e-36 1
CP001096_4468 CDS_4885459-4886751 97.7 5.3e-33 1
CP001096_0820 CDS_871748-870381 87.3 1.9e-29 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001096_4635 1/1 344 422 .. 1 85 [] 129.4 8.5e-44
CP001096_3069 1/1 159 243 .. 1 85 [] 122.9 1.3e-41
CP001096_1159 1/1 520 598 .. 1 85 [] 116.8 1.7e-39
CP001096_0007 1/1 301 383 .. 1 85 [] 115.6 4.1e-39
CP001096_3676 1/1 852 934 .. 1 85 [] 111.4 1.1e-37
CP001096_2316 1/1 434 516 .. 1 85 [] 108.3 1.3e-36
CP001096_4468 1/1 241 320 .. 1 85 [] 97.7 5.3e-33
CP001096_0820 1/1 266 343 .. 1 85 [] 87.3 1.9e-29

Alignments of top-scoring domains:
CP001096_4635: domain 1 of 1, from 344 to 422: score 129.4, E = 8.5e-44
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKN+LAv+QSi++ TlR+ +ld ++e ++gR++A+s++ +L
CP001096_4 344 ELNHRVKNILAVIQSIVTRTLRHGSDLDVARELLIGRIHAMSNVVSL 390

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L++s+W+g++L+ L e P+ a+Ri+++GPd
CP001096_4 391 --LSDSQWQGVMLKGLFEGRAIPH----ADRIEVDGPD 422

CP001096_3069: domain 1 of 1, from 159 to 243: score 122.9, E = 1.3e-41
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKN LA+VQ+i+ Q lR++ +++ +a++ RL+ALsr+HdL
CP001096_3 159 ELNHRVKNVLATVQAIVWQALRTSSDPKTIQQAIESRLVALSRSHDL 205

VpLtrseWagAdLreLleaeLaPygged..aeRitlsGPd<-*
Ltr++W++A L+++++ +L+P++ +d+ ++Ri + G++
CP001096_3 206 --LTRENWESAGLHDIIANALEPFERADglSGRIFIAGDN 243

CP001096_1159: domain 1 of 1, from 520 to 598: score 116.8, E = 1.7e-39
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKN+LA++ S+++Q + sl+ef+ a++gR++ALs aHd+
CP001096_1 520 ELNHRVKNILALIKSLVNQPAGEGKSLEEFASALRGRIMALSFAHDQ 566

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
++rs+ +g+ L +L++aeL+Py a +i l+GPd
CP001096_1 567 --VVRSD-GGGALLDLIQAELSPYP---ASQIALEGPD 598

CP001096_0007: domain 1 of 1, from 301 to 383: score 115.6, E = 4.1e-39
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKNtL++V++i + T+ +++++++f +F+gR+qAL+++H L
CP001096_0 301 ELDHRVKNTLTMVMAICARTAAHERTIEDFQKSFTGRIQALAATHTL 347

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L+ ++W+ ++r++l+aeLaP+++ ++Ri+ +G d
CP001096_0 348 --LSNASWQNLHIRDVLAAELAPFASLSSGRIVTDGLD 383

CP001096_3676: domain 1 of 1, from 852 to 934: score 111.4, E = 1.1e-37
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR N +Av+ +iarQT+Rn+asl+ f ++F +RL AL++a L
CP001096_3 852 ELQHRTNNVFAVILAIARQTVRNSASLETFEQQFGARLLALAQANAL 898

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L++ eW g++L +L+ea+LaP+ g d++R++l GP+
CP001096_3 899 --LVDQEWKGVSLEKLIEAQLAPFIGGDSTRLELVGPT 934

CP001096_2316: domain 1 of 1, from 434 to 516: score 108.3, E = 1.3e-36
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR +N++AvVQSia QT + ++++ef+ +F +RL AL+r+++L
CP001096_2 434 ELQHRTRNLIAVVQSIAEQTMASCGTMEEFRPQFNDRLTALARVQGL 480

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L+rs ++ +++ L++a+L++ g+ d+ R+t+sGP+
CP001096_2 481 --LSRSAQEPITIATLVRAALDALGTVDRNRVTISGPN 516

CP001096_4468: domain 1 of 1, from 241 to 320: score 97.7, E = 5.3e-33
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR KNtLA+V++iarQTlR+ ++ + veaF +RLqALs aH
CP001096_4 241 ELSHRMKNTLAMVMAIARQTLRSIPDQAP-VEAFNARLQALSTAHMA 286

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L + +W A ++e++ +++ +g +R+t+sGP+
CP001096_4 287 --LLQQHWTAAKISEVVKGVVGAVEG--LDRFTISGPA 320

CP001096_0820: domain 1 of 1, from 266 to 343: score 87.3, E = 1.9e-29
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E nHR KN LAvVQ+++ T +f+e++ +RLqALsr +dL
CP001096_0 266 EINHRAKNMLAVVQAMVMRT-----ADRSFAESLGARLQALSRNQDL 307

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L ++W+g ++eL+e++La+ ++ ++R+ ++G++
CP001096_0 308 --LIKRNWSGTPIGELIESQLAAVNDLIGTRVLIEGER 343


Histogram of all scores:
score obs exp (one = represents 17 sequences)
----- --- ---
-15 3 0|=
-14 24 0|==
-13 68 0|====
-12 399 0|========================
-11 498 42|==*===========================
-10 780 542|===============================*==============
-9 988 1342|==========================================================*
-8 889 1393|===================================================== *
-7 635 936|====================================== *
-6 355 511|===================== *
-5 276 253|==============*==
-4 123 120|=======*
-3 85 55|===*=
-2 55 25|=*==
-1 29 11|*=
0 10 5|*
1 7 2|*
2 5 1|*
3 3 0|=
4 1 0|=
> 5 13 -|=


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 5437.3833
P(chi-square) = 0

Total sequences searched: 5246

Whole sequence top hits:
tophits_s report:
Total hits: 8
Satisfying E cutoff: 8
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 8
Satisfying E cutoff: 8
Total memory: 24K


Acknowledgements:

This research is funded by:

Developed by: