Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
41 projects found  

1 accessions found for Chloroherpeton thalassium ATCC 35110  

Data for CP001100  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP001100.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001100_2676 CDS_3246243-3251192 139.0 1.5e-39 1
CP001100_0144 CDS_168109-172587 126.4 5.9e-36 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001100_2676 1/1 1457 1541 .. 1 94 [] 139.0 1.5e-39
CP001100_0144 1/1 1292 1378 .. 1 94 [] 126.4 5.9e-36

Alignments of top-scoring domains:
CP001100_2676: domain 1 of 1, from 1457 to 1541: score 139.0, E = 1.5e-39
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHRVKNNLQvISSLL LQ k +d+ + + ++ +sqnR+ S
CP001100_2 1457 EVHHRVKNNLQVISSLLHLQKSKLQDPQA-----IQIFIDSQNRIHS 1498

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAliH++LY+s+dl +vdf++Y+++L+ +L +y g+ g+++k +
CP001100_2 1499 MALIHQHLYQSDDLNNVDFAAYIDRLLIQLEITY--GNPGVEFK--T 1541

CP001100_0144: domain 1 of 1, from 1292 to 1378: score 126.4, E = 5.9e-36
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E HR KNN+QvISSLL LQ+r f+d+++ ++++++++nR+++
CP001100_0 1292 ELYHRTKNNMQVISSLLALQTRHFQDPDI-----KAVFQDTENRIRT 1333

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAl+H++LY+se+l ++d+ eY+e L++ L sy+v++++i ++ l
CP001100_0 1334 MALVHQKLYQSESLTNIDLQEYIEDLVALLAASYEVSANRILVS--L 1378


Histogram of all scores:
score obs exp (one = represents 10 sequences)
----- --- ---
-15 1 0|=
-14 3 0|=
-13 20 16|=*
-12 98 178|========== *
-11 550 495|=================================================*=====
-10 506 641|=================================================== *
-9 526 541|===================================================== *
-8 400 363|====================================*===
-7 216 215|=====================*
-6 225 120|===========*===========
-5 71 64|======*=
-4 38 34|===*
-3 26 17|=*=
-2 12 9|*=
-1 10 4|*
0 4 2|*
1 1 1|*
> 2 3 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 171.7835
P(chi-square) = 5.066e-31

Total sequences searched: 2710

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: